Copy Link Print Information

GDF-15 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GDF-15 Protein, Mouse (His)
  • Experimental Validation Results for GDF-15 Protein, Mouse (His)
  • GDF-15 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

Background

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It accomplishes this by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons within the parabrachial nucleus and central amygdala, which are part of the 'emergency circuit' responsible for shaping feeding responses in stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and forms a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to facilitate GDF15 internalization and cellular signaling through its interaction with RET.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse GDF-15, His Tag at 1 μg/mL (100 μL/well) can bind Human GFR alpha-like, Fc Tag. The EC50 for this effect is 0.3-10 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His
  • Accession

    Q9Z0J7 (S189-A303)

  • Gene ID
    23886
  • Molecular Construction
    • N-term
    • His
    • GDF-15 (S189-A303)
      Accession # Q9Z0J7
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GDF15; Placental Bone Morphogenetic Protein; Growth Differentiation Factor 15; Macrophage Inhibitory Cytokine 1; MIC-1; NSAID-Activated Gene 1 Protein; NAG-1; NSAID-Regulated Gene 1 Protein; PTGFB; Placental TGF-Beta; PLAB; GDF-15; MIC1; NRG-1; PDF; NSAID (Nonsteroidal Anti-Inflammatory Drug)-Activated Protein 1; Growth/Differentiation Factor 15; Macrophage Inhibitory Cytokine-1; Prostate Differentiation Factor; PTGF-Beta; Non-Steroidal Anti-Inflammatory Drug-Activated Gene-1; HG

  • AA Sequence

    SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

  • Predicted Molecular Mass

    14.6 kDa

  • Molecular Weight

    Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of 0.085% TFA, 30% ACN, 10% trehalose, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Mouse GDF-15, His Tag at 1 μg/mL (100 μL/well) can bind Human GFR alpha-like, Fc Tag. The EC50 for this effect is 0.3-10 ng/mL.

  • GDF-15 Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for GDF-15 Protein, Mouse (His)
  • Experimental Validation Results for GDF-15 Protein, Mouse (His)
  • GDF-15 Protein, Mouse (His) Product Image