GDF-15 Protein, Mouse (His)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It accomplishes this by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons within the parabrachial nucleus and central amygdala, which are part of the 'emergency circuit' responsible for shaping feeding responses in stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and forms a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to facilitate GDF15 internalization and cellular signaling through its interaction with RET.

Mouse

E. coli

N-His

Q9Z0J7-1 (S189-A303)

23886

Full Length of Mature Protein

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.