GMP IL-7 Protein, Human
IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human is the recombinant human-derived IL-7 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human is the recombinant human-derived IL-7 protein, expressed by E. coli , with tag free.
The IL-7 protein serves as a crucial hematopoietic cytokine, playing an indispensable role in the development, expansion, and survival of both naive and memory T-cells as well as B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are executed through a receptor comprised of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, including JAK1 or JAK3, depending on the cell type. This activation leads to the propagation of signals through multiple downstream pathways, such as the PI3K/Akt/mTOR or the JAK-STAT5 pathways. IL-7's interaction with IL7R and CSF2RG highlights its pivotal role in orchestrating diverse signaling cascades crucial for immune cell development and function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P13232-1/NP_000871.1 (D26-H177)
-
Molecular Construction
-
N-term
-
IL-7 (D26-H177)
Accession # P13232-1/NP_000871.1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
IL7; IL7 Nirs Variant 5; Interleukin 7; IL7 Nirs Variant 3; IL-7; IMD130; Interleukin-7
-
AA Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<0.01 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
