IFN-alpha 1/IFNA1 Protein, Mouse (HEK293, hFc)
Based on 1 Customer Validation
IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. IFN-alpha 1/IFNA1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IFN-alpha 1/IFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. IFN-alpha 1/IFNA1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IFN-alpha 1/IFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
IFN alpha 1a Protein, synthesized by macrophages, possesses potent antiviral activities. Its primary role involves the stimulation of two pivotal enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response plays a crucial part in enhancing the host's immune defenses against viral threats.
Verified Bioactivity
Human IFN alpha/beta R1, His Tag captured on CM5 Chip via anti-his antibody can bind Mouse IFN alpha 1, hFc Tag with an affinity constant of 11.96 nM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P01572 (C24-K189)
-
Molecular Construction
-
N-term
-
IFNA1 (C24-K189)
Accession # P01572 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA1; Interferon Alpha-1; Interferon Alpha 1; Interferon Alpha-D; IFN-AlphaD; Interferon-Alpha1; IFN-ALPHA; IFN-Alpha-1; IFNA13; LeIF D; IFNA@; Interferon Alpha-1/13; IFL; IFN-Alpha-1/13; IFN; IFN-Alpha 1b; Interferon Alpha 1b
-
AA Sequence
CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK
-
Predicted Molecular Mass
45.9 kDa
-
Molecular Weight
Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing Tris-Bis PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
