IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
IFN-alpha 5 (IFNA5), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, His) contains 166 a.a. (C24-E189), produced in HEK293 cells with a C-terminal His-tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-alpha 5 (IFNA5), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, His) contains 166 a.a. (C24-E189), produced in HEK293 cells with a C-terminal His-tag.
Background
IFN-alpha 5 (IFNA5; IFN-α5), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[1].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[2].
IFN-alpha 5 involves in innate immunity, and is one of the genes associated with acute viral bronchiolitis (AVB) caused by respiratory syncytial virus (RSV), determining susceptibility to RSV bronchiolitis[3][4].
The excessively expressed interferon-α (IFN-α) might contribute to the uncontrolled inflammatory responses, causing pathological damage during influenza virus infection. However IFN-alpha 5 is dominantly expressed in respiratory epithelial cells from the patients infected with less pathogenic infectious bronchitis virus (IBV)[5].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA5 protein of mouse is very different from human (60.32%).
In Vitro
IFN-α subtype shows dominance in mouse lungs infected with influenza viruses. IFN-α1, IFN-α5, and IFN-α9 are dominantly expressed in the lungs of the mice infected with H1N1 influenza viruses accompanied with the high-level production of CXCL1, more infiltrated neutrophils and more severe damage in mouse lungs[5].
In Vivo
Type I interferons (IFNs) are produced early in response to viral infection and modulate adaptive immunity. Thus IFNA5 enhances the replication of murine cytomegalovirus (MCMV) and helps little about systemic murine cytomegalovirus (MCMV) infection and myocarditis[6].
Verified Bioactivity
Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 0.02-0.1 ng/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q810G2 (C24-E189)
-
Molecular Construction
-
N-term
-
IFNA5 (C24-E189)
Accession # Q810G2 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA5; Interferon Alpha-G; Interferon Alpha 5; IFN-Alpha-5; IFN-AlphaG; LeIF G; Interferon, Alpha 5; Interferon 1AA9; Interferon Alpha-61; INFA5; Interferon Alpha-5; INA5
-
AA Sequence
CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE
-
Predicted Molecular Mass
20.4 kDa
-
Molecular Weight
Approximately 24 kDa & 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]
[2]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5. [Content Brief]
[3]. Hirankarn N, et al. Genetic association of interferon-alpha subtypes 1, 2 and 5 in systemic lupus erythematosus. Tissue Antigens. 2008 Dec;72(6):588-92. [Content Brief]
[4]. Janssen R, et al. Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes. J Infect Dis. 2007 Sep 15;196(6):826-34. [Content Brief]
[5]. Yang L, et al. Diversity of locally produced IFN-α subtypes in human nasopharyngeal epithelial cells and mouse lung tissues during influenza virus infection. Appl Microbiol Biotechnol. 2020 Jul;104(14):6351-6361. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
