IFN-alpha 5/IFNA5 Protein, Rat (HEK293, His, solution)

IFN-alpha 5 (IFNA5), belongs to type I interferon family, is produced by macrophages with antiviral activities^[1].

IFN-alpha 5 (IFNA5; IFN-α5), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[1].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia^[2].
IFN-alpha 5 involves in innate immunity, and is one of the genes associated with acute viral bronchiolitis (AVB) caused by respiratory syncytial virus (RSV), determining susceptibility to RSV bronchiolitis^[3][4].
The excessively expressed interferon-α (IFN-α) might contribute to the uncontrolled inflammatory responses, causing pathological damage during influenza virus infection. However IFN-alpha 5 is dominantly expressed in respiratory epithelial cells from the patients infected with less pathogenic infectious bronchitis virus (IBV)^[5].

Measured in antiviral assay using L929 cells infected with vesicular stomatitis virus (VSV).The ED₅₀ for this effect is typically 4-50 pg/mL.

Rat

HEK293

C-His

XP_001076062 (C24-E189)

690894  [NCBI]

Partial

CALLQQQSLRNKRALTFLTQIRRFSPVSCLKDRKDFGFPLEKMDAQQIQKTQAIPILYELTQQVLNIFTSKDSSAAWDATLLDSFCNNLHQQLNDLKACLMQQSGVQEPPLTQEDSLLYVKEYFHRISVYLREKKHSPCAWEVVRAEVWRALSSSAKLLTRQSKEE

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [2]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5.  [Content Brief]

  [3]. Hirankarn N, et al. Genetic association of interferon-alpha subtypes 1, 2 and 5 in systemic lupus erythematosus. Tissue Antigens. 2008 Dec;72(6):588-92.  [Content Brief]

  [4]. Janssen R, et al. Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes. J Infect Dis. 2007 Sep 15;196(6):826-34.  [Content Brief]

  [5]. Yang L, et al. Diversity of locally produced IFN-α subtypes in human nasopharyngeal epithelial cells and mouse lung tissues during influenza virus infection. Appl Microbiol Biotechnol. 2020 Jul;104(14):6351-6361.  [Content Brief]