IL-1 alpha Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
IL-1 alpha protein is located in cells and is a key cytokine connecting innate immunity and adaptive immunity. After binding to IL1R1 through IL1RAP, it forms a high-affinity receptor complex, initiates a signaling cascade with adapter molecules such as MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Human (HEK293, Fc) is the recombinant human-derived IL-1 alpha protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1 alpha protein is located in cells and is a key cytokine connecting innate immunity and adaptive immunity. After binding to IL1R1 through IL1RAP, it forms a high-affinity receptor complex, initiates a signaling cascade with adapter molecules such as MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Human (HEK293, Fc) is the recombinant human-derived IL-1 alpha protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Interleukin-1 alpha (IL-1 alpha), a cytokine consistently found intracellularly in nearly all quiescent non-hematopoietic cells, plays a pivotal role in inflammation and serves as a crucial link between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, in conjunction with its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex. This complex initiates signaling cascades involving the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4, subsequently leading to the activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha acts as an alarmin, and its release into the extracellular space upon cell death, following cell membrane disruption, induces inflammation and signals the host response to injury or damage. Beyond its role as a danger signal released during cell necrosis, IL-1 alpha also directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. Moreover, IL-1 alpha's interactions with proteins such as TMED10, IL1R1, and S100A13 contribute to its regulatory mechanisms, mediating translocation, secretion, and export processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P01583 (S113-A271)
-
Molecular Construction
-
N-term
-
IL-1α (S113-A271)
Accession # P01583 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1A; IL-1A; Prev. IL1; Preinterleukin 1 Alpha; IL1F1; Interleukin-1 Alpha; Hematopoietin-1; IL-1 Alpha; IL1-ALPHA; Interleukin 1 Alpha; Pro-Interleukin-1-Alpha
-
AA Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
-
Predicted Molecular Mass
44.9 kDa
-
Molecular Weight
Approximately 54 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
Less than 1 EU/µg as determined by LAL test.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)