1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17C
  6. IL-17C Protein, Human (sf9, Fc)

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections. IL-17C Protein, Human (sf9, Fc) is a recombinant human IL-17C protein with hFc tag at the C-terminus and is expressed in Sf9 insect cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고
100 μg Ask For Quote & Lead Time

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections[1]. IL-17C Protein, Human (sf9, Fc) is a recombinant human IL-17C protein with hFc tag at the C-terminus and is expressed in Sf9 insect cells.

Background

Interleukin-17C (IL-17C) belongs to the IL-17 cytokine family. IL-17C is predominantly expressed by epithelial cells.
Human and mouse IL-17C shares 76.68% sequence identity.
IL-17C binds to its functional receptor, a heterodimer formed by IL-17RA and IL-17RE. TLR2, TLR3 and TLR5 upregulate the expression of IL-17C at mucosal surfaces. The expression of IL-17C is also regulated by cytokines (TNF-α, IL-1β and IL-17A). IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides including human beta-defensin 2 (hBD2), Lipocalin 2 (LCN2), and granzyme B. IL-17C also stimulates the release of cytokines (IL-1β, TNF-α, and IL-6).
IL-17C is implicated in autoimmune disorders and bacterial infections[1].

In Vitro

IL-17C is abundantly expressed in inflamed skin[2].
IL-17C (1 ng/mL; 16 h) potentiates TNF-α effects and mediates immune cell recruitment by induction of chemokines in keratinocytes[2].
IL-17C (2 ng/mL; 24 h) and TNF-α (2 ng/mL) induce characteristic psoriasis-related transcriptome genes in both additive and synergistic manners. IL-17C (6 h) increases mRNA expression of TNF-α and IL-6[3].

Species

Human

Source

Sf9 insect cells

Tag

C-hFc

Accession

Q9P0M4 (H19-V197)

Gene ID
Molecular Construction
N-term
IL-17C (H19-V197)
Accession # Q9PM4
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CX2; Cytokine CX2; IL17C; Interleukin-17C
AA Sequence

HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Predicted Molecular Mass
46.5 kDa
분자량

Approximately 45-53 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

IL-17C Protein, Human (sf9, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-17C Protein, Human (sf9, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-17C Protein, Human (sf9, Fc)
Cat. No.:
HY-P75836
수량:
MCE Japan Authorized Agent: