IL-18 Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (His) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (His) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with N-6*His labeled tag.
Background
IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and the modulation of immune responses by polarizing T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to its receptors IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, leading to the synthesis of inflammatory mediators. It synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. IL-18 is also involved in transducing inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with IL18R1 and IL18RAP, with IL18 first binding to IL18R1 to form a low affinity binary complex, which then interacts with IL18RAP to form a high affinity ternary complex that signals within the cell. Additionally, IL-18 interacts with the cargo receptor TMED10 to facilitate its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.
Verified Bioactivity
1.Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED50 for this effect is 0.9227 ng/mL in the presence of 15 ng/mL TNF-alpha, corresponding to a specific activity is 1.08×106 U/mg.
2.Measured by its ability to induce mouse IFN-gamma secretion by activated mouse T cells. The ED50 for this effect is 0.1301 ng/mL, corresponding to a specific activity is 7.686×106 U/mg.
3.Immobilized IL-18 Protein, Mouse can bind Anti-Mouse IL-18 Antibody (YIGIF74-1G7) (HY-P990220). The ED50 for this effect is 11.94 ng/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Biomed Pharmacother
Empagliflozin alleviates the development of autoimmune myocarditis via inhibiting NF-κB-dependent cardiomyocyte pyroptosis. [Abstract]2024 Jan:170:115963. PMID: 38042114
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P70380 (N36-S192)
-
Molecular Construction
-
N-term
-
6*His
-
IL-18 (N36-S192)
Accession # P70380 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL18; Interleukin 18 (Interferon-Gamma-Inducing Factor); Interleukin 18; IFN-Gamma-Inducing Factor; IL-18; Interleukin-1 Gamma; IL1F4; Iboctadekin; IGIF; IL-1 Gamma; Interleukin-18; Interferon-Gamma-Inducing Factor; IL-1g; Interferon Gamma-Inducing Factor
-
AA Sequence
NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 10% trehalose, 50 mM NaCl, 0.1 mM EDTA, 0.05% Tween 80, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mMEDTA, 2 mMDTT, 5% Trehalose, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)