IL-20R beta Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.). IL-20R beta Protein, Cynomolgus (HEK293, Fc) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal Fc-tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.). IL-20R beta Protein, Cynomolgus (HEK293, Fc) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal Fc-tag.

Background

IL-20R beta (IL-12RB), also known as a beta subunit of IL-20 receptor (IL-20RB), belongs to the type II cytokine receptor family. IL-20R beta is widely expressed with highest levels in skin and testis and highly expressed in psoriatic skin[1].
IL-20R beta forms functional heterodimers with different subunit protein. IL-20R beta serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RA, however serves as the receptor for IL-20 and IL-24 by dimerizing with IL-22RA1[2].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1, act function by binding IL-20, and then stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line[1].
However, the expression of both IL-20RB/IL-20RA is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1 bind to IL-24, induce rapid activation of Stat-1 and Stat-3 transcription factors, which appear to play a role in cell survival and proliferation[4].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 38.15 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 38.15 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-20Rβ (D30-A230)差一个氨基酸
      Accession # XP_005545913.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL20RB; Interleukin-20 Receptor Subunit Beta; Prev. FNDC6; IL-20R-Beta; IL-20R2; MGC34923; DIRS1; IL-20RB; Fibronectin Type III Domain Containing 6; Interleukin 20 Receptor Beta; Interleukin 20 Receptor Beta Subunit; Interleukin-20 Receptor II; Interleuki

  • AA Sequence

    DEVAILPAPQNLSVLSTNMKHLLMWSPVTVPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA

  • Molecular Weight

    Approximately 29-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00