1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 alpha
  6. IL-36 alpha/IL-1F6 Protein, Human (158a.a)

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. IL-36 alpha/IL-1F6 Protein, Human (158a.a) is the recombinant human-derived IL-36 alpha/IL-1F6 protein, expressed by E. coli , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. IL-36 alpha/IL-1F6 Protein, Human (158a.a) is the recombinant human-derived IL-36 alpha/IL-1F6 protein, expressed by E. coli , with tag free.

Background

IL-36 alpha/IL-1F6 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating the NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers and involved in local inflammatory responses, sharing similarities with the IL-1 system through the coreceptor IL1RAP. IL-36 alpha/IL-1F6 appears to play a crucial role in skin inflammatory responses by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, promoting tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, it induces the expression of various chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. Additionally, IL-36 alpha/IL-1F6 up-regulates the expression of IL-1A, IL-1B, and IL-6 in cultured monocytes, promotes cell maturation in myeloid dendritic cells, and facilitates dendritic cell maturation while driving T-cell proliferation in monocyte-derived dendritic cells. Its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-36 alpha/IL-1F6 may contribute to pro-inflammatory effects in the lung.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human IL-36 alpha/IL-1F6 is immobilized at 1 μg/mL can bind human IL-1 Rrp2. The ED50 for this effect is 2.24 μg/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9UHA7 (M1-F158)

Gene ID
Molecular Construction
N-term
IL-36α (M1-F158)
Accession # Q9UHA7
C-term
Protein Length

Full Length

Synonyms
FIL1; FIL1 epsilon; FIL1EPSILON; ; FIL1E; IL 1 epsilon; IL 1F6; IL 1H1; IL-1 epsilon; IL-1F6; IL1E; IL1F6; IL1F6_HUMAN; IL1RP2; IL36 alpha; IL36A; Interleukin 1 epsilon; Interleukin 1 family member 6 epsilon; ; Interleukin 1 family member 6; Interleukin 36 alpha; Interleukin-1 epsilon; Interleukin-1 family member 6; MGC129552; MGC129553; MGC151479; MGC151481; OTTMUSP00000012798; RP23-176J12.4
AA Sequence

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Predicted Molecular Mass
17.7 kDa
분자량

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

IL-36 alpha/IL-1F6 Protein, Human (158a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-36 alpha/IL-1F6 Protein, Human (158a.a)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-36 alpha/IL-1F6 Protein, Human (158a.a)
Cat. No.:
HY-P71857
수량:
MCE Japan Authorized Agent: