IL-36 alpha/IL-1F6 Protein, Human (158a.a)
Based on 1 Customer Validation
IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. IL-36 alpha/IL-1F6 Protein, Human (158a.a) is the recombinant human-derived IL-36 alpha/IL-1F6 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. IL-36 alpha/IL-1F6 Protein, Human (158a.a) is the recombinant human-derived IL-36 alpha/IL-1F6 protein, expressed by E. coli , with tag free.
Background
IL-36 alpha/IL-1F6 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating the NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers and involved in local inflammatory responses, sharing similarities with the IL-1 system through the coreceptor IL1RAP. IL-36 alpha/IL-1F6 appears to play a crucial role in skin inflammatory responses by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, promoting tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, it induces the expression of various chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. Additionally, IL-36 alpha/IL-1F6 up-regulates the expression of IL-1A, IL-1B, and IL-6 in cultured monocytes, promotes cell maturation in myeloid dendritic cells, and facilitates dendritic cell maturation while driving T-cell proliferation in monocyte-derived dendritic cells. Its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-36 alpha/IL-1F6 may contribute to pro-inflammatory effects in the lung.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human IL-36 alpha/IL-1F6 is immobilized at 1 μg/mL can bind human IL-1 Rrp2. The ED50 for this effect is 2.24 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9UHA7 (M1-F158)
-
Molecular Construction
-
N-term
-
IL-36α (M1-F158)
Accession # Q9UHA7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
IL36A; Interleukin-1 Epsilon; Prev. IL1F6; FIL1 Epsilon; IL-1F6; IL-1 Epsilon; FIL1E; MGC129553; IL1(EPSILON); MGC129552; FIL1; IL-1F6 (FIL-1-Epsilon); Interleukin 1 Family, Member 6 (Epsilon); FIL1(EPSILON); Interleukin-1 Family Member 6; IL1E; Interleuk
-
AA Sequence
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)