ISG15/UCRP Protein, Human (C-His)
Based on 1 Customer Validation
ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag. ,
Background
ISG15/UCRP is a ubiquitin-like protein that plays a pivotal role in the innate immune response to viral infection, either through conjugation to target proteins (ISGylation) or as a free protein. ISGylation involves an enzymatic cascade mediated by E1, E2, and E3 enzymes, leading to the covalent attachment of ISG15 to lysine residues on target proteins such as IFIT1, MX1/MxA, and PPM1B. ISG15 modulates diverse cellular functions via ISGylation, including activation of EIF2AK2/PKR, inhibition of RIGI's antiviral signaling, and enhancement of EIF4E2's translation-suppressive activity. It exhibits broad-spectrum antiviral activity against both DNA and RNA viruses (e.g., influenza A, HIV-1, and Ebola virus) by disrupting viral budding or impairing viral protein functions. The secreted form of ISG15 acts as a cytokine, inducing NK cell proliferation, neutrophil chemotaxis, and ITGAL/ITGB2-mediated activation of SRC family kinases (e.g., LYN, HCK, FGR) to promote IFNG and IL10 secretion, contributing to antimycobacterial immunity.
Verified Bioactivity
Measured in a cell proliferation assay using PANC-1 cells. The ED50 for this effect is typically 16.47 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
AAH09507.1 (G2-G157)
-
Gene ID9636
-
Molecular Construction
-
N-term
-
ISG15 (G2-G157)
Accession # AAH09507.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Ubiquitin-like protein ISG15 Chain
-
Synonyms
ISG15; Interferon-Induced 17 KDa Protein; Prev. G1P2; HUCRP; UCRP; IP17; Ubiquitin Cross-Reactive Protein; Interferon-Induced 17-KDa/15-KDa Protein; Ubiquitin-Like Protein ISG15; Interferon-Stimulated Protein, 15 KDa; IFI15; IMD38; Interferon, Alpha-Induc
-
AA Sequence
GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)