ISG15/UCRP Protein, Human (C-His)

Customer Review

Based on 1 Customer Validation

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag. ,

Background

ISG15/UCRP is a ubiquitin-like protein that plays a pivotal role in the innate immune response to viral infection, either through conjugation to target proteins (ISGylation) or as a free protein. ISGylation involves an enzymatic cascade mediated by E1, E2, and E3 enzymes, leading to the covalent attachment of ISG15 to lysine residues on target proteins such as IFIT1, MX1/MxA, and PPM1B. ISG15 modulates diverse cellular functions via ISGylation, including activation of EIF2AK2/PKR, inhibition of RIGI's antiviral signaling, and enhancement of EIF4E2's translation-suppressive activity. It exhibits broad-spectrum antiviral activity against both DNA and RNA viruses (e.g., influenza A, HIV-1, and Ebola virus) by disrupting viral budding or impairing viral protein functions. The secreted form of ISG15 acts as a cytokine, inducing NK cell proliferation, neutrophil chemotaxis, and ITGAL/ITGB2-mediated activation of SRC family kinases (e.g., LYN, HCK, FGR) to promote IFNG and IL10 secretion, contributing to antimycobacterial immunity.

Verified Bioactivity

Measured in a cell proliferation assay using PANC-1 cells. The ED50 for this effect is typically 16.47 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using PANC-1 cells. The ED50 for this effect is typically 16.47 ng/mL, corresponding to a specific activity is 6.07×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ISG15 (G2-G157)
      Accession # AAH09507.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Ubiquitin-like protein ISG15 Chain

  • Synonyms

    ISG15; Interferon-Induced 17 KDa Protein; Prev. G1P2; HUCRP; UCRP; IP17; Ubiquitin Cross-Reactive Protein; Interferon-Induced 17-KDa/15-KDa Protein; Ubiquitin-Like Protein ISG15; Interferon-Stimulated Protein, 15 KDa; IFI15; IMD38; Interferon, Alpha-Induc

  • AA Sequence

    GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00