JAM-B/CD322 Protein, Mouse (HEK293, Fc)

JAM-B/CD322 protein regulates cellular processes through interactions with JAM3. It aids hematopoietic cell homing and retention in the bone marrow and facilitates leukocyte extravasation. JAM-B is involved in spermatogenesis, inhibits myelination, promotes myocyte fusion, and may contribute to angiogenesis. Its multifunctionality emphasizes its significance in cellular and physiological processes. JAM-B/CD322 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAM-B/CD322 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

JAM-B/CD322 protein regulates cellular processes through interactions with JAM3. It aids hematopoietic cell homing and retention in the bone marrow and facilitates leukocyte extravasation. JAM-B is involved in spermatogenesis, inhibits myelination, promotes myocyte fusion, and may contribute to angiogenesis. Its multifunctionality emphasizes its significance in cellular and physiological processes. JAM-B/CD322 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAM-B/CD322 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

JAM-B/CD322 protein functions as a junctional adhesion molecule, orchestrating heterotypic cell-cell interactions with its receptor JAM3 to regulate diverse cellular processes. It plays a crucial role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. In the context of leukocyte extravasation, JAM-B is central not only to transmigration but also to tethering and rolling of leukocytes along the endothelium, processes dependent on its binding to the integrin alpha-4/beta-1. Furthermore, JAM-B is involved in spermatogenesis, mediating interactions between Sertoli and germ cells and contributing to the anchorage of germ cells onto Sertoli cells, as well as the assembly of cell polarity complexes during spermatid differentiation. Acting as an inhibitory somatodendritic cue, it prevents the myelination of non-axonal parts of neurons. Additionally, JAM-B participates in myocyte fusion during myogenesis and may play a role in angiogenesis. The multifaceted functions of JAM-B underscore its importance in various cellular and physiological processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • JAM-A (F29-N236)
      Accession # Q9JI59
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    JAM2; CD322; Prev. C21orf43; VEJAM; VE-JAM; JAM-IT/VE-JAM; JAM-B; CD322 Antigen; JAM-2; PRO245; Vascular Endothelial Junction-Associated Molecule; IBGC8; Junctional Adhesion Molecule B; Junctional Adhesion Molecule 2; JAMB

  • AA Sequence

    FSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

  • Predicted Molecular Mass

    50.3 kDa

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00