Lipocalin-2/NGAL Protein, Rat (sf9, His)

Customer Review

Based on 1 Customer Validation

Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Rat (sf9, His) is the recombinant rat-derived Lipocalin-2/NGAL protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Rat (sf9, His) is the recombinant rat-derived Lipocalin-2/NGAL protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Lipocalin-2/NGAL, a multifaceted iron-trafficking protein, participates in diverse biological processes including apoptosis, innate immunity, and renal development. Through its association with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), Lipocalin-2 binds and shuttles iron, dynamically influencing cellular iron concentrations based on the holo-24p3 (iron-bound) or apo-24p3 (iron-free) forms. The interaction with the SLC22A17 receptor mediates iron release or chelation, finely regulating intracellular iron levels. In apoptosis triggered by interleukin-3 (IL3) deprivation, the iron-loaded form prevents apoptosis, while the iron-free form induces BCL2L11/BIM expression, leading to programmed cell death. Lipocalin-2 also contributes to innate immunity by sequestering bacterial siderophores, such as enterobactin, and exhibits the ability to bind siderophores from M. tuberculosis. Structurally, Lipocalin-2 exists as a monomer, homodimer (disulfide-linked), and forms a heterodimer (disulfide-linked) with MMP9. These diverse interactions underscore the versatility of Lipocalin-2 in orchestrating critical cellular and immune responses.

Verified Bioactivity

Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in Lipocalin2. It binds >1.0 μM of Fe(DHBA)3.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NGAL (Q21-N198)
      Accession # P30152
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LCN2; P25; Lipocalin 2; Migration-Stimulating Factor Inhibitor; NGAL; Lipocalin 2 (Oncogene 24p3); Neutrophil Gelatinase-Associated Lipocalin; Siderocalin LCN2; Oncogene 24p3; Lipocalin-2; 24p3; MSFI; 25 KDa Alpha-2-Microglobulin-Related Subunit Of MMP-9;

  • AA Sequence

    QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

  • Predicted Molecular Mass

    21.9 kDa

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00