Lipocalin-2/NGAL Protein, Rat (sf9, His)

Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Rat (sf9, His) is the recombinant rat-derived Lipocalin-2/NGAL protein, expressed by Sf9 insect cells , with C-His labeled tag.

Lipocalin-2/NGAL, a multifaceted iron-trafficking protein, participates in diverse biological processes including apoptosis, innate immunity, and renal development. Through its association with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), Lipocalin-2 binds and shuttles iron, dynamically influencing cellular iron concentrations based on the holo-24p3 (iron-bound) or apo-24p3 (iron-free) forms. The interaction with the SLC22A17 receptor mediates iron release or chelation, finely regulating intracellular iron levels. In apoptosis triggered by interleukin-3 (IL3) deprivation, the iron-loaded form prevents apoptosis, while the iron-free form induces BCL2L11/BIM expression, leading to programmed cell death. Lipocalin-2 also contributes to innate immunity by sequestering bacterial siderophores, such as enterobactin, and exhibits the ability to bind siderophores from M. tuberculosis. Structurally, Lipocalin-2 exists as a monomer, homodimer (disulfide-linked), and forms a heterodimer (disulfide-linked) with MMP9. These diverse interactions underscore the versatility of Lipocalin-2 in orchestrating critical cellular and immune responses.

Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in Lipocalin2. It binds >1.0 μM of Fe(DHBA)3.

Rat

Sf9 insect cells

C-His

P30152 (Q21-N198)

170496  [NCBI]

Full Length of Mature Protein

QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

Approximately 25 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.