Lipocalin-2/NGAL Protein, Rat (sf9, His)
Based on 1 Customer Validation
Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Rat (sf9, His) is the recombinant rat-derived Lipocalin-2/NGAL protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Lipocalin-2/NGAL is a multifaceted iron transporter involved in multiple biological processes, including apoptosis, innate immunity, and kidney development. Lipocalin-2 dynamically affects cellular iron concentration through binding to the siderophore 2,3-dihydroxybenzoate. Lipocalin-2/NGAL Protein, Rat (sf9, His) is the recombinant rat-derived Lipocalin-2/NGAL protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Lipocalin-2/NGAL, a multifaceted iron-trafficking protein, participates in diverse biological processes including apoptosis, innate immunity, and renal development. Through its association with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), Lipocalin-2 binds and shuttles iron, dynamically influencing cellular iron concentrations based on the holo-24p3 (iron-bound) or apo-24p3 (iron-free) forms. The interaction with the SLC22A17 receptor mediates iron release or chelation, finely regulating intracellular iron levels. In apoptosis triggered by interleukin-3 (IL3) deprivation, the iron-loaded form prevents apoptosis, while the iron-free form induces BCL2L11/BIM expression, leading to programmed cell death. Lipocalin-2 also contributes to innate immunity by sequestering bacterial siderophores, such as enterobactin, and exhibits the ability to bind siderophores from M. tuberculosis. Structurally, Lipocalin-2 exists as a monomer, homodimer (disulfide-linked), and forms a heterodimer (disulfide-linked) with MMP9. These diverse interactions underscore the versatility of Lipocalin-2 in orchestrating critical cellular and immune responses.
Verified Bioactivity
Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in Lipocalin2. It binds >1.0 μM of Fe(DHBA)3.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P30152 (Q21-N198)
-
Molecular Construction
-
N-term
-
NGAL (Q21-N198)
Accession # P30152 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LCN2; P25; Lipocalin 2; Migration-Stimulating Factor Inhibitor; NGAL; Lipocalin 2 (Oncogene 24p3); Neutrophil Gelatinase-Associated Lipocalin; Siderocalin LCN2; Oncogene 24p3; Lipocalin-2; 24p3; MSFI; 25 KDa Alpha-2-Microglobulin-Related Subunit Of MMP-9;
-
AA Sequence
QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
-
Predicted Molecular Mass
21.9 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)