LRP-10 Protein, Human (HEK293, Fc)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, Fc) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-hFc labeled tag.

The LRP-10 protein emerges as a probable receptor with potential involvement in the internalization of lipophilic molecules and/or signal transduction. This receptor is speculated to play a role in the uptake of lipoprotein APOE in the liver, suggesting a function in lipid metabolism and cellular processes related to lipoprotein transport. The precise mechanisms and signaling pathways associated with LRP-10 in mediating the internalization of lipophilic molecules warrant further investigation to comprehensively understand its role in cellular uptake and potential contributions to lipid homeostasis.

Human

HEK293

C-hFc

Q7Z4F1-1 (H17-K440)

26020  [NCBI]

Extracellular Domain

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Approximately 80-90 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.