LRP-10 Protein, Human (HEK293, Fc)
The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, Fc) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, Fc) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The LRP-10 protein emerges as a probable receptor with potential involvement in the internalization of lipophilic molecules and/or signal transduction. This receptor is speculated to play a role in the uptake of lipoprotein APOE in the liver, suggesting a function in lipid metabolism and cellular processes related to lipoprotein transport. The precise mechanisms and signaling pathways associated with LRP-10 in mediating the internalization of lipophilic molecules warrant further investigation to comprehensively understand its role in cellular uptake and potential contributions to lipid homeostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q7Z4F1-1 (H17-K440)
-
Molecular Construction
-
N-term
-
LRP-10 (H17-K440)
Accession # Q7Z4F1-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LRP10; DKFZP564C1940; LDL Receptor Related Protein 10; MGC8675; MSTP087; LRP-10; MST087; Low Density Lipoprotein Receptor-Related Protein 10; LRP9; LRP10 Protein; Low-Density Lipoprotein Receptor-Related Protein 10
-
AA Sequence
HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK
-
Predicted Molecular Mass
73 kDa
-
Molecular Weight
Approximately 80-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
