Mer Protein, Human (Active, sf9, Flag)
Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1, or GAS6, regulating cell survival, migration, differentiation, and apoptotic cell phagocytosis (endocytosis). Ligand binding induces autophosphorylation of MERTK, creating a docking site for downstream molecules. MERTK, Human (Active, sf9, Flag) is the recombinant human-derived MERTK protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1, or GAS6, regulating cell survival, migration, differentiation, and apoptotic cell phagocytosis (endocytosis). Ligand binding induces autophosphorylation of MERTK, creating a docking site for downstream molecules. MERTK, Human (Active, sf9, Flag) is the recombinant human-derived MERTK protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
The Mer protein, a receptor tyrosine kinase, transduces signals from the extracellular matrix by binding to various ligands, including LGALS3, TUB, TULP1, or GAS6. It is involved in regulating diverse physiological processes, including cell survival, migration, differentiation, and the phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain, creating docking sites for downstream signaling molecules. Upon activation by ligand, Mer interacts with GRB2 or PLCG2 and induces the phosphorylation of MAPK1, MAPK2, FAK/PTK2, or RAC1. MERTK signaling is implicated in macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization, and engulfment. In the retinal pigment epithelium (RPE), it serves as a regulator of rod outer segment fragments' phagocytosis. Moreover, Mer plays a crucial role in inhibiting Toll-like receptors (TLRs)-mediated innate immune responses by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-Flag
-
Accession
Q12866 (R528-M999)
-
Gene ID10461
-
Molecular Construction
-
N-term
-
Flag
-
Mer (R528-M999)
Accession # Q12866 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
MERTK; Mer; MER Proto-Oncogene, Tyrosine Kinase; C-Mer Proto-Oncogene Tyrosine Kinase; Receptor Tyrosine Kinase MerTK; Receptor Protein-Tyrosine Kinase; Tyrosine-Protein Kinase Mer; Uncharacterized Protein MERTK; Proto-Oncogene C-Mer; MER Receptor Tyrosine Kinase; Tyro12; STK Kinase; C-Eyk; C-Mer; RP38; MER
-
AA Sequence
RVQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)