MERTK Protein, Mouse (HEK293, His)
Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1 or GAS6.Mer is critical in processes such as cell survival, migration, differentiation, and phagocytosis of apoptotic cells, and autophosphorylation occurs upon ligand binding.MERTK Protein, Mouse (HEK293, His) is the recombinant mouse-derived MERTK protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1 or GAS6.Mer is critical in processes such as cell survival, migration, differentiation, and phagocytosis of apoptotic cells, and autophosphorylation occurs upon ligand binding.MERTK Protein, Mouse (HEK293, His) is the recombinant mouse-derived MERTK protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The Mer protein is a receptor tyrosine kinase that mediates cellular signaling from the extracellular matrix to the cytoplasm through binding to ligands such as LGALS3, TUB, TULP1, or GAS6. It plays a crucial role in various physiological processes, including cell survival, migration, differentiation, and the phagocytosis of apoptotic cells. Activation of Mer by ligand binding leads to autophosphorylation on its intracellular domain, creating binding sites for downstream signaling molecules. This, in turn, triggers interactions with GRB2 or PLCG2 and subsequent phosphorylation of MAPK1, MAPK2, FAK/PTK2, or RAC1. Mer signaling is involved in macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization, and engulfment. Notably, within the retinal pigment epithelium (RPE), Mer serves as a regulator of phagocytosis of rod outer segment fragments. Additionally, Mer plays a pivotal role in inhibiting the innate immune response triggered by Toll-like receptors (TLRs) by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
Q60805 (G19-M497)
-
Molecular Construction
-
N-term
-
MERTK (G19-M497)
Accession # Q60805 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MERTK; Mer; MER Proto-Oncogene, Tyrosine Kinase; C-Mer Proto-Oncogene Tyrosine Kinase; Receptor Tyrosine Kinase MerTK; Receptor Protein-Tyrosine Kinase; Tyrosine-Protein Kinase Mer; Uncharacterized Protein MERTK; Proto-Oncogene C-Mer; MER Receptor Tyrosin
-
AA Sequence
GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM
-
Predicted Molecular Mass
55.0 kDa
-
Molecular Weight
Approximately 66-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)