MORF4L2 Protein, Human (His)
Based on 1 Customer Validation
The MORF4L2 protein is an important component of the NuA4 histone acetyltransferase complex and promotes transcriptional activation by acetylating histones H4 and H2A. This modification alters nucleosome-DNA interactions and promotes interactions with other transcription-positive proteins. MORF4L2 Protein, Human (His) is the recombinant human-derived MORF4L2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The MORF4L2 protein is an important component of the NuA4 histone acetyltransferase complex and promotes transcriptional activation by acetylating histones H4 and H2A. This modification alters nucleosome-DNA interactions and promotes interactions with other transcription-positive proteins. MORF4L2 Protein, Human (His) is the recombinant human-derived MORF4L2 protein, expressed by E. coli , with C-6*His labeled tag.
Background
MORF4L2 protein serves as an integral component of the NuA4 histone acetyltransferase complex, contributing to the transcriptional activation of select genes through the acetylation of nucleosomal histones H4 and H2A. This modification not only alters nucleosome-DNA interactions but also facilitates the interaction of modified histones with other proteins that positively regulate transcription. The NuA4 complex, where MORF4L2 plays a vital role, is implicated in diverse cellular processes, including growth induction, growth arrest, replicative senescence, apoptosis, and DNA repair. RUVBL1 and RUVBL2 associate with EP400 to contribute ATPase and helicase activities to the NuA4 complex. MORF4L2 is also a component of the MSIN3A complex, which functions in transcriptional repression through the deacetylation of nucleosomal histones. Within the NuA4 complex, MORF4L2 interacts with various subunits, including KAT5/TIP60, EP400, TRRAP/PAF400, and others. Moreover, MORF4L2 is part of the MSIN3A histone deacetylase complex, collaborating with SIN3A, HDAC2, ARID4B, MORF4L1, RBBP4/RbAp48, and RBBP7/RbAp46. Its interactions with MRFAP1 and RB1, along with potential associations with the TLE family of transcriptional repressors, underscore MORF4L2's intricate involvement in chromatin modification and gene regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q15014 (M1-L288)
-
Molecular Construction
-
N-term
-
MORF4L2 (M1-L288)
Accession # Q15014 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
MORF4L2; MORF-Related Gene X Protein; Mortality Factor 4 Like 2; Protein MSL3-2; MRGX; MORF-Related Gene X; Mortality Factor 4-Like Protein 2; MSL3-2 Protein; KIAA0026; MORFL2; Transcription Factor-Like Protein MRGX
-
AA Sequence
MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
-
Predicted Molecular Mass
33.4 kDa
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)