Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi)

The Nectin-4 Protein IgV domain is pivotal in cell adhesion, participating in trans-homophilic and -heterophilic interactions, notably with NECTIN1. While it doesn't serve as an alpha-herpesvirus entry receptor, it functions as a receptor for measles virus, enabling virus entry into host cells. This dual role underscores the importance of Nectin-4 in cell adhesion and its specific role as a measles virus infection receptor. Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Nectin-4 protein IgV domain, expressed by HEK293 , with C-Avi, C-His labeled tag.

The Nectin-4 Protein IgV domain plays a crucial role in cell adhesion, engaging in both trans-homophilic and -heterophilic interactions. Specifically, it forms interactions with NECTIN1, contributing to cellular adhesion processes. However, it does not function as a receptor for alpha-herpesvirus entry into cells. In the context of microbial infection, the Nectin-4 IgV domain acts as a receptor for measles virus, facilitating the entry of the virus into host cells. This highlights the dual role of Nectin-4 in cell adhesion and its significance as a specific receptor for measles virus infection.

Immobilized Biotinylated Human Nectin-4 IgV Domain, His Tag at 0.5 μg/ml (100 μl/well) on the streptavidin precoated plate (5 μg/ml). Dose response curve for Anti-Nectin-4 Antibody, hFc Tag with the EC₅₀ of 3.4 ng/ml determined by ELISA.

Human

HEK293

C-Avi;C-8*His

Q96NY8-1 (G32-L146)

81607  [NCBI]

Partial

Biotin

GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL

Approximately 16-20 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.