Copy Link Print Information

Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The Nectin-4 Protein IgV domain is pivotal in cell adhesion, participating in trans-homophilic and -heterophilic interactions, notably with NECTIN1. While it doesn't serve as an alpha-herpesvirus entry receptor, it functions as a receptor for measles virus, enabling virus entry into host cells. This dual role underscores the importance of Nectin-4 in cell adhesion and its specific role as a measles virus infection receptor. Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Nectin-4 protein IgV domain, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The Nectin-4 Protein IgV domain is pivotal in cell adhesion, participating in trans-homophilic and -heterophilic interactions, notably with NECTIN1. While it doesn't serve as an alpha-herpesvirus entry receptor, it functions as a receptor for measles virus, enabling virus entry into host cells. This dual role underscores the importance of Nectin-4 in cell adhesion and its specific role as a measles virus infection receptor. Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Nectin-4 protein IgV domain, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The Nectin-4 Protein IgV domain plays a crucial role in cell adhesion, engaging in both trans-homophilic and -heterophilic interactions. Specifically, it forms interactions with NECTIN1, contributing to cellular adhesion processes. However, it does not function as a receptor for alpha-herpesvirus entry into cells. In the context of microbial infection, the Nectin-4 IgV domain acts as a receptor for measles virus, facilitating the entry of the virus into host cells. This highlights the dual role of Nectin-4 in cell adhesion and its significance as a specific receptor for measles virus infection.

Verified Bioactivity

Immobilized Biotinylated Human Nectin-4 IgV Domain, His Tag at 0.5 μg/ml (100 μl/well) on the streptavidin precoated plate (5 μg/ml). Dose response curve for Anti-Nectin-4 Antibody, hFc Tag with the EC50 of 3.4 ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    Q96NY8-1 (G32-L146)

  • Gene ID
    81607  [NCBI]
  • Molecular Construction
    • N-term
    • Nectin-4 (G32-L146)
      Accession # Q96NY8-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Full Length of Ig-like V-type domain

  • Conjugation

    Biotin

  • Synonyms

    NECTIN4; Poliovirus Receptor-Related Protein 4; Prev. PVRL4; Poliovirus Receptor-Related 4; Nectin-4; Nectin 4; PRR4; EDSS1; LNIR; Nectin Cell Adhesion Molecule 4; Ig Superfamily Receptor LNIR

  • AA Sequence

    GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL

  • Predicted Molecular Mass

    15.8 kDa

  • Molecular Weight

    Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • Nectin-4 IgV domain Protein, Human (Biotinylated, HEK293, His-Avi) Product Image