NEK7 Protein, Human (Inactive, sf9, His-GST)
Based on 1 publication(s) in Google Scholar
The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (sf9, His-GST) is the recombinant human-derived NEK7 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (sf9, His-GST) is the recombinant human-derived NEK7 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
NEK7 protein, a pivotal kinase, plays a crucial role in mitotic cell cycle progression by contributing to the microtubule nucleation activity of the centrosome, ensuring robust mitotic spindle formation, and facilitating cytokinesis. Its diverse functions include the phosphorylation of EML4 at 'Ser-146,' promoting dissociation from microtubules during mitosis and thereby facilitating efficient chromosome congression. NEK7 extends its impact beyond mitotic events by phosphorylating RPS6KB1 and serving as an essential activator of the NLRP3 inflammasome assembly. Independently of its kinase activity, NEK7 unlocks NLRP3 within the microtubule organizing center, promoting the formation of the NLRP3:PYCARD complex and activation of CASP1. Notably, NEK7 acts as a cellular switch, ensuring mutual exclusivity between the inflammasome response and cell division; its interaction with NEK9 prevents interaction with NLRP3 and inflammasome activation during mitosis. These multifaceted functions position NEK7 as a key orchestrator in both mitotic progression and the inflammasome response, highlighting its regulatory significance in diverse cellular processes.
Verified Bioactivity
The product demonstrated no detectable kinase activity in an ATP/ADP-based kinase assay.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
NEK7 couples SDHB to orchestrate respiratory chain electron transport homeostasis that impedes liver fibrosis. [Abstract]2025 Nov 28;16(1):10751. PMID: 41315267
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q8TDX7-1 (M1-S302)
-
Molecular Construction
-
N-term
-
His-GST
-
NEK7 (M1-S302)
Accession # Q8TDX7-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NEK7; Never In Mitosis A-Related Kinase 7; NIMA Related Kinase 7; NimA-Related Protein Kinase 7; NIMA (Never In Mitosis Gene A)-Related Kinase 7; NEK6-Subfamily Protein Kinase; Serine/Threonine-Protein Kinase Nek7
-
AA Sequence
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS
-
Predicted Molecular Mass
62.4 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 0.5 mM GSH, 0.5 mM PMSF, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)