OX40 Ligand/TNFSF4 Protein, Mouse (HEK293, rFc)
OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40 Ligand/TNFSF4 Protein, Mouse (HEK293, rFc) is a recombinant mouse OX40 Ligand (Q49-L198) with N-terminal rFc tag, which is produced in HEK293.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Mouse (HEK293, rFc) is a recombinant mouse OX40 Ligand (Q49-L198) with N-terminal rFc tag, which is produced in HEK293.
Background
OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is expressed on antigen-presenting cells, such as B cells, dendritic cells (DCs), and macrophages, and airway smooth muscle cells[3]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family.
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
Mouse OX40 Ligand shares 81.31% aa sequence identity with rat, and shares <70% aa sequence identity with human.
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[4]. OX40 Ligand is critical for Th1 and Th2 responses in mice allergic inflammation[5].
In Vitro
OX4 Ligand (mouse, 1, 2 ng/mL) increases proliferation of CD4+ T cells isolated from mouse spleen[6].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-rFc
-
Accession
P43488 (Q49-L198)
-
Molecular Construction
-
N-term
-
rFc
-
OX40L (Q49-L198)
Accession # P43488 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFSF4; Tumor Necrosis Factor (Ligand) Superfamily Member 4; Prev. TXGP1; Tumor Necrosis Factor Superfamily Member 4; Tumor Necrosis Factor Ligand Superfamily Member 4; Tumor Necrosis Factor Ligand 2B; OX-40L; OX40 Antigen Ligand; CD252; CD252 Antigen; Gp
-
AA Sequence
QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
-
Predicted Molecular Mass
44.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141(2):494-499. [Content Brief]
[2]. Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637. [Content Brief]
[3]. Croft M, et al. The significance of OX40 and OX40L to T-cell biology and immune disease. Immunol Rev. 2009 May;229(1):173-91. [Content Brief]
[4]. Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117(10):2910-7 [Content Brief]
[5]. Arestides RS, et al. Costimulatory molecule OX40L is critical for both Th1 and Th2 responses in allergic inflammation. Eur J Immunol. 2002 Oct;32(10):2874-80. [Content Brief]
[6]. Lei W, et al. Crucial role of OX40/OX40L signaling in a murine model of asthma. Mol Med Rep. 2018 Mar;17(3):4213-4220. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
