Copy Link Print Information

OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant biotinylated human OX40 (L29-A216) with C-terminal Avi and His tag, which is produced in HEK293.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi)
  • OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant biotinylated human OX40 (L29-A216) with C-terminal Avi and His tag, which is produced in HEK293.

Background

OX40 (TNFRSF4), a member of TNFR superfamily, is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells, but also found in natural killer T cells, natural killer cells, neutrophils, and human airway smooth muscle cells. Human OX40 shares <30% aa sequence identity with mouse and rat. Mouse OX40 shares 90% aa sequence identity with rat[1].
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[3]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease[1].

In Vitro

OX40 increases expression of RANTES protein in HUVECs[4].

Verified Bioactivity

1.Measured by its binding ability in SPR assay. Human OX40 Ligand Trimer His-Flag immobilized on CM5 Chip can bind Biotinylated Human OX40 His-Avi with an affinity constant of 1.00 μM.
2.Immobilized Biotinylated Human OX40, His Tag at 1μg/mL (100μL/well) on the streptavidin precoated plate (5μg/mL). Dose response curve for Human OX40 Ligand, hFc Tag with the EC50 of ≤6 ng/mL determined by ELISA.
3.Loaded Ordastobart (HY-P991336) on ProA biosensor, can bind OX40/TNFRSF4 Protein, Human with an affinity constant of 1.30E-10 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Ordastobart (HY-P991336) on ProA biosensor, can bind OX40/TNFRSF4 Protein, Human with an affinity constant of 1.30E-10 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    P43489 (L29-A216)

  • Gene ID
    7293  [NCBI]
  • Molecular Construction
    • N-term
    • OX40 (L29-A216)
      Accession # P43489
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    TNFRSF4; CD134 Antigen; Prev. TXGP1L; Tumor Necrosis Factor Receptor Superfamily, Member 4; Tumor Necrosis Factor Receptor Superfamily Member 4; Lymphoid Activation Antigene ACT35; OX40L Receptor; OX40 Cell Surface Antigen; ACT35; OX40 Homologue; CD134; A

  • AA Sequence

    LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

  • Predicted Molecular Mass

    23.2 kDa

  • Molecular Weight

    Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141(2):494-499. [Content Brief]

[2]. Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637. [Content Brief]

[3]. Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117(10):2910-7. [Content Brief]

[4]. Kotani A, et al. Signaling of gp34 (OX40 ligand) induces vascular endothelial cells to produce a CC chemokine RANTES/CCL5. Immunol Lett. 2002 Oct 21;84(1):1-7. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Loaded Ordastobart (HY-P991336) on ProA biosensor, can bind OX40/TNFRSF4 Protein, Human with an affinity constant of 1.30E-10 M as determined in BLI assay.

  • OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • Experimental Validation Results for OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi)
  • OX40/TNFRSF4 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image