OX40/TNFRSF4 Protein, Mouse (HEK293, His-Avi)

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs^[1][2]. OX40/TNFRSF4 Protein, Mouse (His-Avi) is a recombinant mouse OX40 (V20-P211) with C-terminal Avi and His tag, which is produced in HEK293.

OX40 (TNFRSF4), a member of TNFR superfamily, is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells, but also found in natural killer T cells, natural killer cells, neutrophils, and human airway smooth muscle cells. Mouse OX40 shares 90% aa sequence identity with rat. Mouse OX40 shares <30% aa sequence identity with human^[1].
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs^[1][2].
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity^[3]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease^[1]. For example, OX40 interacts with OX40 Ligand is critical for Th1 and Th2 responses in mice allergic inflammation^[4].

OX4 increases expression of RANTES protein in HUVECs^[5].

OX4 (rat, 5 μg/kg, i.c.v) increases expression of the OX4L, reduces the neuronal apoptosis, and improves short and long-term neurological function deficits^[6].

Immobilized Mouse OX-40 Ligand, hFc Tag at 5 μg/ml (100μl/well) on the plate. Dose response curve for Mouse OX-40, His Tag with the EC₅₀ of 1.06 μg/ml determined by ELISA.

Mouse

HEK293

C-Avi;C-8*His

P47741 (V20-P211)

22163  [NCBI]

Extracellular Domain

VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141(2):494-499.  [Content Brief]

  [2]. Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637.  [Content Brief]

  [3]. Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117(10):2910-7.  [Content Brief]

  [4]. Arestides RS, et al. Costimulatory molecule OX40L is critical for both Th1 and Th2 responses in allergic inflammation. Eur J Immunol. 2002 Oct;32(10):2874-80.  [Content Brief]

  [5]. Kotani A, et al. Signaling of gp34 (OX40 ligand) induces vascular endothelial cells to produce a CC chemokine RANTES/CCL5. Immunol Lett. 2002 Oct 21;84(1):1-7.  [Content Brief]

  [6]. Wu LY, et al. Recombinant OX40 attenuates neuronal apoptosis through OX40-OX40L/PI3K/AKT signaling pathway following subarachnoid hemorrhage in rats. Exp Neurol. 2020 Apr;326:113179.  [Content Brief]