p38 gamma/MAPK12 Protein, Human (sf9, His-GST)

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (sf9, His-GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (sf9, His-GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

p38 gamma/MAPK12, a serine/threonine kinase and crucial component of the MAP kinase signal transduction pathway, is among the four p38 MAPKs playing a pivotal role in cellular responses triggered by extracellular stimuli such as pro-inflammatory cytokines or physical stress. This pathway leads to the direct activation of transcription factors like ELK1 and ATF2, with p38 MAPKs phosphorylating a diverse array of proteins, estimated to have approximately 200 to 300 substrates each. Among its downstream kinases is MAPKAPK2, activated through phosphorylation to further phosphorylate additional targets. MAPK12 contributes to myoblast differentiation and down-regulation of cyclin D1 in response to hypoxia in adrenal cells, suggesting its role in inhibiting cell proliferation while promoting differentiation. Notably, MAPK12 phosphorylates DLG1, and following osmotic shock, it increases its association with nuclear DLG1, impacting mRNA processing and/or gene transcription to aid cell adaptation to osmolarity changes. Additionally, MAPK12 regulates UV-induced checkpoint signaling and repair of UV-induced DNA damage, influences glucose uptake in muscle cells, and is essential for the normal kinetochore localization of PLK1, preventing chromosomal instability and supporting mitotic cell viability. Its signaling positively regulates the expansion of transient amplifying myogenic precursor cells during muscle growth and regeneration.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • p38γ (M1-L367)
      Accession # P53778-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MAPK12; Stress-Activated Protein Kinase 3; Prev. SAPK3; MAP Kinase 12; ERK6; MAPK 12; P38gamma; ERK-6; SAPK-3; Mitogen-Activated Protein Kinase 3; PRKM12; Mitogen-Activated Protein Kinase; Mitogen-Activated Protein Kinase P38 Gamma; ERK3; Extracellular Si

  • AA Sequence

    MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

  • Predicted Molecular Mass

    69.8 kDa

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00