PD-L1 Protein, Rabbit (HEK293, His)

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived PD-L1 protein, expressed by HEK293 , with C-His labeled tag. The total length of PD-L1 Protein, Rabbit (HEK293, His) is 220 a.a., with molecular weight of 32-44 kDa.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived PD-L1 protein, expressed by HEK293 , with C-His labeled tag. The total length of PD-L1 Protein, Rabbit (HEK293, His) is 220 a.a., with molecular weight of 32-44 kDa.

Background

PD-L1 Protein assumes a critical role in both the induction and maintenance of immune tolerance to self, acting as a ligand for the inhibitory receptor PDCD1/PD-1 and thereby modulating the activation threshold of T-cells, ultimately limiting their effector response. Additionally, PD-L1 may function as a costimulatory molecule for T-cell subsets that predominantly produce interleukin-10 (IL10) through an as yet unidentified activating receptor. Beyond its role as an immune checkpoint, PD-L1 also acts as a transcription coactivator, translocating into the nucleus in response to hypoxia and interacting with phosphorylated STAT3 to promote the transcription of GSDMC, leading to pyroptosis. Exploited by tumors to attenuate anti-tumor immunity and escape immune system destruction, the PDCD1-mediated inhibitory pathway facilitated by PD-L1 interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. Blocking the PDCD1-mediated pathway has shown promise in reversing exhausted T-cell phenotypes and normalizing anti-tumor responses, providing a rationale for cancer immunotherapy.

Technical Parameters

  • Species Rabbit
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PD-L1 (F19-H238)
      Accession # G1SUI3
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD274; B7 Homolog 1; Prev. PDCD1LG1; B7-H; PD-L1; PDCD1 Ligand 1; B7H1; PDCD1L1; PDL1; HPD-L1; Programmed Cell Death 1 Ligand 1; Programmed Death Ligand 1; CD274 Antigen; ADMIO5; CD274 Molecule; B7-H1

  • AA Sequence

    FTVTVPKDLYVVEYGSNVTIECKFPVEKQLDLNSLVVYWEMGDKQIIQFVHGNENLKVQHSSYRQRAQLLKDQLHLGIAALQITDVKLRDAGVYCCMISYGGADYKRITLKVNAPYHKINQRISVDPVTSEHELTCQAEGYPEAEVIWTSSDHQILHGKTDVTNSNREEKFFNVTSTLRINTTANEIFYCTFQRPGPEANNTAKLIIPEPPVFHRNERTH

  • Predicted Molecular Mass

    27.1 kDa

  • Molecular Weight

    Approximately 32-44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00