1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-B
  6. PDGF-BB Protein, Rhesus Macaque (P.pastoris, His)

PDGF-BB Protein, Rhesus Macaque (P.pastoris, His)

Cat. No.: HY-P74641
Handling Instructions Technical Support

PDGF-BB Protein is a member of the PDGF family and promotes cell proliferation, survival, and migration by binding to the tyrosine kinase PDGF receptor. PDGF-BB Protein promotes tendon healing and neuroregulation after spinal cord hemisection in primates. PDGF-BB Protein, Rhesus Macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

PDGF-BB Protein is a member of the PDGF family and promotes cell proliferation, survival, and migration by binding to the tyrosine kinase PDGF receptor. PDGF-BB Protein promotes tendon healing and neuroregulation after spinal cord hemisection in primates. PDGF-BB Protein, Rhesus Macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.

Background

Platelet-derived growth factor (PDGF) is a potent mitogen and chemical attractant of mesenchymal cells and osteoblasts and stimulates angiogenic molecules that play an important role in bone regeneration. Platelet-derived growth factor-BB, a member of the PDGF family, promotes cell proliferation, survival and migration by binding to the tyrosine kinase PDGF receptor. PDGF-BB has a beneficial effect on hemorrhagic shock, which is closely related to the improvement of vascular reactivity and hemodynamics by targeting CX43. PDGF-BB acts in subsomatic cavernous smooth muscle cells (CCSMCs) by binding to PDGFR. PDGF-BB promotes tendon healing. PDGF-BB plays an important role in neuroregulation after spinal cord hemisection in primates[1][2][3].

Species

Rhesus Macaque

Source

P. pastoris

Tag

N-His

Accession

XP_001097395.1 (S82-T190)

Gene ID
Molecular Construction
N-term
His
PDGF-BB (S82-T190)
Accession # XP_001097395.1
C-term
Protein Length

Partial

Synonyms
Platelet-derived growth factor subunit B; PDGF-2; PDGFB
AA Sequence

SLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Predicted Molecular Mass
14.2 kDa
분자량

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

PDGF-BB Protein, Rhesus Macaque (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PDGF-BB Protein, Rhesus Macaque (P.pastoris, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PDGF-BB Protein, Rhesus Macaque (P.pastoris, His)
Cat. No.:
HY-P74641
수량:
MCE Japan Authorized Agent: