PDGF-BB Protein, Rhesus Macaque (P.pastoris, His)
PDGF-BB Protein is a member of the PDGF family and promotes cell proliferation, survival, and migration by binding to the tyrosine kinase PDGF receptor. PDGF-BB Protein promotes tendon healing and neuroregulation after spinal cord hemisection in primates. PDGF-BB Protein, Rhesus Macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Rhesus Macaque
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PDGF-BB Protein is a member of the PDGF family and promotes cell proliferation, survival, and migration by binding to the tyrosine kinase PDGF receptor. PDGF-BB Protein promotes tendon healing and neuroregulation after spinal cord hemisection in primates. PDGF-BB Protein, Rhesus Macaque (P.pastoris, His) is the recombinant Rhesus Macaque-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.
Background
Platelet-derived growth factor (PDGF) is a potent mitogen and chemical attractant of mesenchymal cells and osteoblasts and stimulates angiogenic molecules that play an important role in bone regeneration. Platelet-derived growth factor-BB, a member of the PDGF family, promotes cell proliferation, survival and migration by binding to the tyrosine kinase PDGF receptor. PDGF-BB has a beneficial effect on hemorrhagic shock, which is closely related to the improvement of vascular reactivity and hemodynamics by targeting CX43. PDGF-BB acts in subsomatic cavernous smooth muscle cells (CCSMCs) by binding to PDGFR. PDGF-BB promotes tendon healing. PDGF-BB plays an important role in neuroregulation after spinal cord hemisection in primates[1][2][3].
Technical Parameters
-
Species Rhesus Macaque
-
Source P. pastoris
-
Tag N-His
-
Accession
XP_001097395.1 (S82-T190)
-
Molecular Construction
-
N-term
-
His
-
PDGF-BB (S82-T190)
Accession # XP_001097395.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
