PDGF-CC Protein, Human (HEK293, Fc)
PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
Background
PDGF-CC, a multifaceted growth factor, assumes a pivotal role in orchestrating diverse cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. As a potent mitogen and chemoattractant for mesenchymal cells, PDGF-CC is indispensable for the normal formation of the embryonic skeleton, particularly the craniofacial skeleton and palate. Its significance extends to skin morphogenesis during embryonic development and holds a critical position in wound healing, guiding the intricate stages of inflammation, proliferation, and remodeling. Moreover, PDGF-CC emerges as a key player in angiogenesis, blood vessel development, and fibrotic processes, where it contributes to the transformation of interstitial fibroblasts into myofibroblasts and collagen deposition. Beyond its role in maintaining PDGF domain latency, the CUB domain exhibits mitogenic activity in coronary artery smooth muscle cells. Intriguingly, within the nucleus, PDGF-CC appears to serve additional functions. Structurally, PDGF-CC forms homodimers linked by disulfide bonds and engages in interactions with PDGFRA homodimers, as well as heterodimers formed by PDGFRA and PDGFRB, highlighting its intricate involvement in a myriad of cellular activities. The CUB domain of PDGF-CC further interacts with PLAT, emphasizing its diverse and dynamic roles in cellular regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q9NRA1-1 (V235-G345)
-
Molecular Construction
-
N-term
-
hFc
-
PDGF-CC (V235-G345)
Accession # Q9NRA1-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFC; Platelet-Derived Growth Factor C; Platelet Derived Growth Factor C; PDGF-C; Fallotein; VEGF-E; SCDGF; Secretory Growth Factor-Like Protein; Spinal Cord-Derived Growth Factor
-
AA Sequence
VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
-
Predicted Molecular Mass
39 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)