PON3 Protein, Human (S50N, sf9, His)

PON3 is less active against organophosphates and aromatic carboxylic acid esters and is particularly capable of rapidly hydrolyzing lactones, including statin precursors such as lovastatin. It is capable of hydrolyzing aromatic lactones and specific 5- or 6-membered ring lactones, but is less efficient for simple or polar substituted lactones. PON3 Protein, Human (S50N, sf9, His) is the recombinant human-derived PON3 protein, expressed by Sf9 insect cells , with N-His labeled tag.

PON3 displays low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Notably, it exhibits rapid hydrolysis of lactones, including statin prodrugs like lovastatin. Moreover, PON3 is capable of hydrolyzing aromatic lactones and 5- or 6-member ring lactones with aliphatic substituents, while it does not efficiently hydrolyze simple lactones or those with polar substituents. These substrate specificities highlight PON3's role in the metabolism of certain ester compounds and lactones, providing insights into its enzymatic activities and potential implications in drug metabolism.

Human

Sf9 insect cells

N-His

Q15166 (M1-L354, S50N)

5446  [NCBI]

Full Length of Isoform-1

MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVADVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL

Approximately 45 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 1 mM CaCl₂, 10% glycerol, 0.1% DDM.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.