PON3 Protein, Human (S50N, sf9, His)
Based on 1 Customer Validation
PON3 is less active against organophosphates and aromatic carboxylic acid esters and is particularly capable of rapidly hydrolyzing lactones, including statin precursors such as lovastatin. It is capable of hydrolyzing aromatic lactones and specific 5- or 6-membered ring lactones, but is less efficient for simple or polar substituted lactones. PON3 Protein, Human (S50N, sf9, His) is the recombinant human-derived PON3 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PON3 is less active against organophosphates and aromatic carboxylic acid esters and is particularly capable of rapidly hydrolyzing lactones, including statin precursors such as lovastatin. It is capable of hydrolyzing aromatic lactones and specific 5- or 6-membered ring lactones, but is less efficient for simple or polar substituted lactones. PON3 Protein, Human (S50N, sf9, His) is the recombinant human-derived PON3 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
PON3 displays low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Notably, it exhibits rapid hydrolysis of lactones, including statin prodrugs like lovastatin. Moreover, PON3 is capable of hydrolyzing aromatic lactones and 5- or 6-member ring lactones with aliphatic substituents, while it does not efficiently hydrolyze simple lactones or those with polar substituents. These substrate specificities highlight PON3's role in the metabolism of certain ester compounds and lactones, providing insights into its enzymatic activities and potential implications in drug metabolism.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q15166 (M1-L354, S50N)
-
Molecular Construction
-
N-term
-
His
-
PON3 (M1-L354, S50N)
Accession # Q15166 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PON3; Arylesterase 3; Paraoxonase 3; Paraoxanase-3; Serum Paraoxonase/Lactonase 3; Paraoxonase
-
AA Sequence
MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVADVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL
-
Predicted Molecular Mass
42 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 1 mM CaCl2, 10% glycerol, 0.1% DDM.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
