RBBP8 Protein, Human (His, Strep)

RBBP8 Protein, Human (His, Strep) is the recombinant human-derived RBBP8, expressed by E. coli , with Strep, His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RBBP8 Protein, Human (His, Strep) is the recombinant human-derived RBBP8, expressed by E. coli , with Strep, His labeled tag. ,

Background

RBBP8 is an endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in DNA-end resection, the first step of double-strand break (DSB) repair through the homologous recombination (HR) pathway. HR is restricted to the S and G2 phases of the cell cycle and preferentially repairs DSBs resulting from replication fork collapse. RBBP8 is a key determinant of DSB repair pathway choice, as it commits cells to HR by preventing classical non-homologous end-joining (NHEJ). It specifically promotes the endonuclease activity of the MRN complex to clear DNA ends containing protein adducts: recruited to DSBs by NBN following phosphorylation by CDK1, and promotes the endonuclease activity of MRE11 to clear protein-DNA adducts and generate clean double-strand break ends. It functions downstream of the MRN complex and ATM, promoting ATR activation and its recruitment to DSBs in the S/G2 phase, facilitating the generation of ssDNA. As a component of the BRCA1-RBBP8 complex, it regulates CHEK1 activation and controls cell cycle G2/M checkpoints upon DNA damage. During immunoglobulin heavy chain class-switch recombination, it promotes microhomology-mediated alternative end joining (A-NHEJ) and plays an essential role in chromosomal translocations (by similar). It binds preferentially to DNA Y-junctions and to DNA substrates with blocked ends and promotes intermolecular DNA bridging.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Strep;His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    RBBP8; CTBP-Interacting Protein; Prev. SCKL2; Retinoblastoma-Interacting Protein And Myosin-Like; CtIP; CtBP-Interacting Protein; RIM; Seckel Syndrome 2; DNA Endonuclease RBBP8; RBBP-8; COM1; JAWAD; Sporulation In The Absence Of SPO11 Protein 2 Homolog; J

  • AA Sequence

    SLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGG

  • Predicted Molecular Mass

    7.9 kDa

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00