1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RBBP8 Protein, Human (His, Strep)

RBBP8 Protein, Human (His, Strep) is the recombinant human-derived RBBP8, expressed by E. coli , with Strep, His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RBBP8 Protein, Human (His, Strep) is the recombinant human-derived RBBP8, expressed by E. coli , with Strep, His labeled tag. ,

Background

RBBP8 is an endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in DNA-end resection, the first step of double-strand break (DSB) repair through the homologous recombination (HR) pathway. HR is restricted to the S and G2 phases of the cell cycle and preferentially repairs DSBs resulting from replication fork collapse. RBBP8 is a key determinant of DSB repair pathway choice, as it commits cells to HR by preventing classical non-homologous end-joining (NHEJ). It specifically promotes the endonuclease activity of the MRN complex to clear DNA ends containing protein adducts: recruited to DSBs by NBN following phosphorylation by CDK1, and promotes the endonuclease activity of MRE11 to clear protein-DNA adducts and generate clean double-strand break ends. It functions downstream of the MRN complex and ATM, promoting ATR activation and its recruitment to DSBs in the S/G2 phase, facilitating the generation of ssDNA. As a component of the BRCA1-RBBP8 complex, it regulates CHEK1 activation and controls cell cycle G2/M checkpoints upon DNA damage. During immunoglobulin heavy chain class-switch recombination, it promotes microhomology-mediated alternative end joining (A-NHEJ) and plays an essential role in chromosomal translocations (by similar). It binds preferentially to DNA Y-junctions and to DNA substrates with blocked ends and promotes intermolecular DNA bridging.

Species

Human

Source

E. coli

Tag

Strep;His

Accession

Q99708-1 (S641-G685)

Gene ID

5932

Protein Length

Partial

Synonyms
CTIP
AA Sequence

SLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGG

Predicted Molecular Mass
7.9 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RBBP8 Protein, Human (His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RBBP8 Protein, Human (His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RBBP8 Protein, Human (His, Strep)
Cat. No.:
HY-P703184
Quantity:
MCE Japan Authorized Agent: