RBBP8 Protein, Human (His, Strep)
RBBP8 Protein, Human (His, Strep) is the recombinant human-derived RBBP8, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RBBP8 Protein, Human (His, Strep) is the recombinant human-derived RBBP8, expressed by E. coli , with Strep, His labeled tag. ,
Background
RBBP8 is an endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in DNA-end resection, the first step of double-strand break (DSB) repair through the homologous recombination (HR) pathway. HR is restricted to the S and G2 phases of the cell cycle and preferentially repairs DSBs resulting from replication fork collapse. RBBP8 is a key determinant of DSB repair pathway choice, as it commits cells to HR by preventing classical non-homologous end-joining (NHEJ). It specifically promotes the endonuclease activity of the MRN complex to clear DNA ends containing protein adducts: recruited to DSBs by NBN following phosphorylation by CDK1, and promotes the endonuclease activity of MRE11 to clear protein-DNA adducts and generate clean double-strand break ends. It functions downstream of the MRN complex and ATM, promoting ATR activation and its recruitment to DSBs in the S/G2 phase, facilitating the generation of ssDNA. As a component of the BRCA1-RBBP8 complex, it regulates CHEK1 activation and controls cell cycle G2/M checkpoints upon DNA damage. During immunoglobulin heavy chain class-switch recombination, it promotes microhomology-mediated alternative end joining (A-NHEJ) and plays an essential role in chromosomal translocations (by similar). It binds preferentially to DNA Y-junctions and to DNA substrates with blocked ends and promotes intermolecular DNA bridging.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q99708-1 (S641-G685)
-
Gene ID5932
-
Protein Length
Partial
-
Synonyms
RBBP8; CTBP-Interacting Protein; Prev. SCKL2; Retinoblastoma-Interacting Protein And Myosin-Like; CtIP; CtBP-Interacting Protein; RIM; Seckel Syndrome 2; DNA Endonuclease RBBP8; RBBP-8; COM1; JAWAD; Sporulation In The Absence Of SPO11 Protein 2 Homolog; J
-
AA Sequence
SLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGG
-
Predicted Molecular Mass
7.9 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)