RSK2 Protein, Human (sf9)
RSK2 is a kinase downstream of ERK signaling and plays a critical role in mediating mitosis and stress responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK2, Human (sf9) is the recombinant human-derived RSK2 protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RSK2 is a kinase downstream of ERK signaling and plays a critical role in mediating mitosis and stress responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK2, Human (sf9) is the recombinant human-derived RSK2 protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
Background
RSK2, a serine/threonine-protein kinase, operates downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling, orchestrating mitogenic and stress-induced cellular responses. It plays a pivotal role in the activation of transcription factors such as CREB1, ETV1/ER81, and NR4A1/NUR77, contributing to cellular proliferation, survival, and differentiation. RSK2 modulates translation by phosphorylating RPS6 and EIF4B, facilitating the assembly of the preinitiation complex. Additionally, it intricately regulates mTOR signaling, represses the pro-apoptotic functions of BAD and DAPK1, and is involved in cell survival mechanisms. In fibroblasts, RSK2 is essential for EGF-stimulated phosphorylation of CREB1 and histone H3, leading to the transcriptional activation of immediate-early genes. Upon mitogenic stimulation, it phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors. In response to insulin-derived signals, RSK2 indirectly influences the transcriptional regulation of genes by phosphorylating GSK3B. Additionally, RSK2 participates in the mTOR nutrient-sensing pathway, mediating TSC2 phosphorylation and regulating mTORC1 activity. Furthermore, RSK2 plays diverse roles, including promoting the survival of hepatic stellate cells, regulating the cell cycle by phosphorylating CDKN1B, and acting as a regulator of osteoblast differentiation by mediating phosphorylation of ATF4. In various cellular contexts, RSK2 engages in intricate regulatory networks, negatively regulating EGF-induced MAPK1/3 phosphorylation, phosphorylating SOS1, and controlling the RPS6KA-EPHA2 signaling pathway to influence cell migration.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag Tag Free
-
Accession
P51812 (P40-P359)
-
Gene ID6197
-
Molecular Construction
-
N-term
-
(P40-P359)
Accession # P51812 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RPS6KA3; Pp90RSK2; Prev. MRX19; RSK-2; Prev. CLS; Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3; RSK2; Ribosomal Protein S6 Kinase, 90kD, Polypeptide 3; Insulin-Stimulated Protein Kinase 1; Non-Specific Serine/Threonine Protein Kinase; HU-3; Epididymi
-
AA Sequence
PQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDP
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)