RYK Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

RYK protein, together with FZD8, serves as a potential Wnt co-receptor for WNT1, WNT3, WNT3A and WNT5A, affecting neuronal differentiation, axon guidance and neurite growth. After WNT3 stimulation, RYK undergoes C-terminal cleavage and transfers intracellular products to the nucleus, which is critical for neuronal development. RYK Protein, Human (HEK293, Fc) is the recombinant human-derived RYK protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RYK protein, together with FZD8, serves as a potential Wnt co-receptor for WNT1, WNT3, WNT3A and WNT5A, affecting neuronal differentiation, axon guidance and neurite growth. After WNT3 stimulation, RYK undergoes C-terminal cleavage and transfers intracellular products to the nucleus, which is critical for neuronal development. RYK Protein, Human (HEK293, Fc) is the recombinant human-derived RYK protein, expressed by HEK293 , with C-hFc labeled tag.

Background

RYK Protein appears to function as a potential coreceptor, collaborating with FZD8, for Wnt proteins like WNT1, WNT3, WNT3A, and WNT5A. Its involvement spans critical processes such as neuron differentiation, axon guidance, corpus callosum establishment, and neurite outgrowth, emphasizing its significance in neural development. Upon stimulation by WNT3, the receptor undergoes C-terminal cleavage in its transmembrane region, facilitating the translocation of the C-terminal intracellular product from the cytoplasm to the nucleus. This translocated product assumes a crucial role in mediating neuronal development. The multifaceted engagement of RYK in Wnt signaling pathways underscores its potential as a key player in orchestrating intricate cellular processes integral to neural differentiation and growth. Further exploration of RYK's functions and regulatory mechanisms may provide deeper insights into its specific contributions to neuronal development.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Human RYK, at 2μg/mL (100 μL/well) can bind Wnt3a. The KD for this effect is 5.675 nM.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RYK (P26-R227)
      Accession # P34925/NP_002949.2
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    RYK; JTK5A Protein Tyrosine Kinase; Prev. JTK5A; RYK Receptor-Like Tyrosine Kinase; D3S3195; Receptor Protein-Tyrosine Kinase; JTK5; Hydroxyaryl-Protein Kinase; RYK1; Receptor Like Tyrosine Kinase; Tyrosine-Protein Kinase RYK

  • AA Sequence

    PPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTR

  • Molecular Weight

    Approximately 49.1 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00