SAA2/Serum Amyloid A-2 Protein, Mouse (His)
SAA2/Serum Amyloid A-2 Protein, Mouse (His) is the recombinant human-derived SAA2 protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
SAA2/Serum Amyloid A-2 Protein, Mouse (His) is the recombinant human-derived SAA2 protein, expressed by E. coli, with N-6*His labeled tag.
Background
Serum amyloid A (SAA) is a family of high-density lipoprotein (HDL) related apolipoproteins in plasma, with three subtypes, SAA1, SAA2, and SAA3. SAA2 is mainly expressed and induced in the liver, and the SAA2 gene is regulated by pro-inflammatory factors IL-1, IL-6 and TNF-α. SAA2 is a major acute-phase protein that is highly expressed in inflammatory and tissue injury responses. SAA2 also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of SAA2 have been linked to chronic inflammatory diseases, including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. SAA2 may also be a potential biomarker for certain tumors[1][2][3][4].
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P05367 (G20-Y122)
-
Gene ID6289
-
Molecular Construction
-
N-term
-
6*His
-
SAA2 (G20-Y122)
Accession # P05367 -
C-term
-
-
Protein Length
Full Length of SAA2 Chain
-
Synonyms
SAA2; Alternative Protein SAA2; Serum Amyloid A2; Serum Amyloid A Protein; Serum Amyloid A-2 Protein; SAA
-
AA Sequence
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
-
Predicted Molecular Mass
15.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
