1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SCF Protein, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Stem Cell Factor (SCF) operates as a pivotal ligand for the receptor-type protein-tyrosine kinase KIT, exerting indispensable regulatory functions in cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KIT, SCF activates diverse signaling pathways, triggering phosphorylation events that lead to the activation of key kinases such as AKT1 and components of the MAP kinase cascade, including RAS, RAF1, and MAPK1/ERK2 or MAPK3/ERK1. Furthermore, SCF-driven signaling involves the activation of STAT family members (STAT1, STAT3, and STAT5) and PLCG1, culminating in the production of crucial cellular signaling molecules. Operating synergistically with other cytokines, likely interleukins, SCF forms homodimers and non-covalently links to KIT, resulting in the formation of a heterotetramer that mediates KIT dimerization and subsequent activation through autophosphorylation. This intricate network underscores SCF's multifaceted role in orchestrating diverse cellular processes and developmental pathways.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P21581-1 (Q26-A189)

Gene ID
Molecular Construction
N-term
SCF (Q26-A189)
Accession # P21581-1
6*His
C-term
Protein Length

Partial

Synonyms
FPH2; KIT ligand; Kitl; KITLG; KL-1; Mast cell growth factor; MGF; MGFSHEP7; SCF; SCFStem cell factor; SFc-Kit ligand; SLF; steel factor
AA Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Predicted Molecular Mass
19.4 kDa
Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SCF Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SCF Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCF Protein, Rat (HEK293, His)
Cat. No.:
HY-P71130
Quantity:
MCE Japan Authorized Agent: