1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. Cytokine-independent Survival Kinase (SGK3) SGK
  5. SGK3 Protein, Human (Active, sf9, GST)

The SGK3 protein is an important serine/threonine protein kinase that complexly controls diverse ion channels, transporters, and key cellular processes, affecting growth, proliferation, survival, and migration. SGK3 exhibits multiple effects by upregulating channels such as Na(+), K(+), epithelial Ca(2+), chloride, and transporters such as creatine. SGK3 Protein, Human (sf9, GST) is the recombinant human-derived SGK3 protein, expressed by Sf9 insect cells , with GST tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SGK3 protein is an important serine/threonine protein kinase that complexly controls diverse ion channels, transporters, and key cellular processes, affecting growth, proliferation, survival, and migration. SGK3 exhibits multiple effects by upregulating channels such as Na(+), K(+), epithelial Ca(2+), chloride, and transporters such as creatine. SGK3 Protein, Human (sf9, GST) is the recombinant human-derived SGK3 protein, expressed by Sf9 insect cells , with GST tag.

Background

SGK3 Protein, a serine/threonine-protein kinase, intricately regulates a diverse array of ion channels, membrane transporters, and cellular processes essential for growth, proliferation, survival, and migration. It exerts its influence by up-regulating key channels, including Na(+) channels (SCNN1A/ENAC and SCN5A), K(+) channels (KCNA3/KV1.3, KCNE1, KCNQ1, and KCNH2/HERG), epithelial Ca(2+) channels (TRPV5 and TRPV6), chloride channel (BSND), creatine transporter (SLC6A8), Na(+)/dicarboxylate cotransporter (SLC13A2/NADC1), Na(+)-dependent phosphate cotransporter (SLC34A2/NAPI-2B), amino acid transporters (SLC1A5/ASCT2 and SLC6A19), glutamate transporters (SLC1A3/EAAT1, SLC1A6/EAAT4, and SLC1A7/EAAT5), glutamate receptors (GRIA1/GLUR1 and GRIK2/GLUR6), Na(+)/H(+) exchanger (SLC9A3/NHE3), and the Na(+)/K(+) ATPase. Notably, SGK3 plays a crucial role in the regulation of renal tubular phosphate transport and bone density. Moreover, it demonstrates its versatility by phosphorylating NEDD4L and GSK3B, positively regulating ER transcription activity through FLII phosphorylation, and negatively modulating ITCH/AIP4 function, thereby preventing efficient sorting of CXCR4 to lysosomes.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

Q96BR1-1 (M1-L496)

Gene ID

100533105  [NCBI]

Protein Length

Full Length of Isoform-1

Synonyms
Serine/threonine-protein kinase Sgk3; Cytokine-independent survival kinase; SGK3; CISK; SGKL
AA Sequence

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL

Predicted Molecular Mass
68 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SGK3 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SGK3 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P76063
Quantity:
MCE Japan Authorized Agent: