SGK3 Protein, Human (Active, sf9, GST)

The SGK3 protein is an important serine/threonine protein kinase that complexly controls diverse ion channels, transporters, and key cellular processes, affecting growth, proliferation, survival, and migration. SGK3 exhibits multiple effects by upregulating channels such as Na(+), K(+), epithelial Ca(2+), chloride, and transporters such as creatine. SGK3 Protein, Human (sf9, GST) is the recombinant human-derived SGK3 protein, expressed by Sf9 insect cells , with GST tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SGK3 protein is an important serine/threonine protein kinase that complexly controls diverse ion channels, transporters, and key cellular processes, affecting growth, proliferation, survival, and migration. SGK3 exhibits multiple effects by upregulating channels such as Na(+), K(+), epithelial Ca(2+), chloride, and transporters such as creatine. SGK3 Protein, Human (sf9, GST) is the recombinant human-derived SGK3 protein, expressed by Sf9 insect cells , with GST tag.

Background

SGK3 Protein, a serine/threonine-protein kinase, intricately regulates a diverse array of ion channels, membrane transporters, and cellular processes essential for growth, proliferation, survival, and migration. It exerts its influence by up-regulating key channels, including Na(+) channels (SCNN1A/ENAC and SCN5A), K(+) channels (KCNA3/KV1.3, KCNE1, KCNQ1, and KCNH2/HERG), epithelial Ca(2+) channels (TRPV5 and TRPV6), chloride channel (BSND), creatine transporter (SLC6A8), Na(+)/dicarboxylate cotransporter (SLC13A2/NADC1), Na(+)-dependent phosphate cotransporter (SLC34A2/NAPI-2B), amino acid transporters (SLC1A5/ASCT2 and SLC6A19), glutamate transporters (SLC1A3/EAAT1, SLC1A6/EAAT4, and SLC1A7/EAAT5), glutamate receptors (GRIA1/GLUR1 and GRIK2/GLUR6), Na(+)/H(+) exchanger (SLC9A3/NHE3), and the Na(+)/K(+) ATPase. Notably, SGK3 plays a crucial role in the regulation of renal tubular phosphate transport and bone density. Moreover, it demonstrates its versatility by phosphorylating NEDD4L and GSK3B, positively regulating ER transcription activity through FLII phosphorylation, and negatively modulating ITCH/AIP4 function, thereby preventing efficient sorting of CXCR4 to lysosomes.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SGK3; CISK; Prev. SGKL; Serum/Glucocorticoid Regulated Kinase-Like; Prev. SGK2; Serum/Glucocorticoid-Regulated Kinase-Like; Serine/Threonine-Protein Kinase Sgk3; Serum/Glucocorticoid-Regulated Kinase 3; Cytokine-Independent Survival Kinase; Serum/Glucocorticoid Regulated Kinase Family Member 3; Serum/Glucocorticoid Regulated Kinase Family, Member 3

  • AA Sequence

    MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL

  • Predicted Molecular Mass

    68 kDa

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00