SIRT3 Protein, Human
Based on 1 Customer Validation
SIRT3 is an NAD-dependent protein deacetylase that dynamically affects the acetylation of mitochondrial target proteins, such as ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and the ATP synthase subunit ATP5PO. Its deacetylation activity regulates cellular energy metabolism and fine-tunes tissue-specific ATP levels. SIRT3 Protein, Human is the recombinant human-derived SIRT3 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
SIRT3 is an NAD-dependent protein deacetylase that dynamically affects the acetylation of mitochondrial target proteins, such as ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and the ATP synthase subunit ATP5PO. Its deacetylation activity regulates cellular energy metabolism and fine-tunes tissue-specific ATP levels. SIRT3 Protein, Human is the recombinant human-derived SIRT3 protein, expressed by E. coli , with tag free.
Background
SIRT3, a NAD-dependent protein deacetylase, intricately modulates the acetylation status of key lysine residues in various mitochondrial target proteins, including ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and ATP synthase subunit ATP5PO. By catalyzing deacetylation, SIRT3 actively participates in the regulation of cellular energy metabolism, exerting influence on tissue-specific ATP levels and contributing to the fine-tuning of metabolic responses. Under metabolic stress conditions, SIRT3 deacetylates the transcription factor FOXO3, recruiting both FOXO3 and mitochondrial RNA polymerase POLRMT to mitochondrial DNA, thereby enhancing mtDNA transcription. Additionally, SIRT3 plays a crucial role in ceramide metabolism by deacetylating ceramide synthases CERS1, CERS2, and CERS6, promoting mitochondrial ceramide accumulation. Furthermore, SIRT3 regulates hepatic lipogenesis by utilizing NAD(+) substrate imported by SLC25A47, triggering downstream activation of the PRKAA1/AMPK-alpha signaling cascade. This activation ultimately leads to the downregulation of sterol regulatory element-binding protein (SREBP) transcriptional activities, mitigating ATP-consuming lipogenesis and restoring cellular energy balance.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9NTG7 (S118-K399)
-
Gene ID23410
-
Molecular Construction
-
N-term
-
SIRT3 (S118-K399)
Accession # Q9NTG7 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SIRT3; Sirtuin (Silent Mating Type Information Regulation 2, S.Cerevisiae, Homolog) 3; Sirtuin 3; Mitochondrial Nicotinamide Adenine Dinucleotide-Dependent Deacetylase; SIR2L3; Silent Mating Type Information Regulation 2, S.Cerevisiae, Homolog 3; NAD-Depe
-
AA Sequence
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
-
Predicted Molecular Mass
31.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)