1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SIRT3 Protein, Human

SIRT3 is an NAD-dependent protein deacetylase that dynamically affects the acetylation of mitochondrial target proteins, such as ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and the ATP synthase subunit ATP5PO. Its deacetylation activity regulates cellular energy metabolism and fine-tunes tissue-specific ATP levels. SIRT3 Protein, Human is the recombinant human-derived SIRT3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SIRT3 is an NAD-dependent protein deacetylase that dynamically affects the acetylation of mitochondrial target proteins, such as ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and the ATP synthase subunit ATP5PO. Its deacetylation activity regulates cellular energy metabolism and fine-tunes tissue-specific ATP levels. SIRT3 Protein, Human is the recombinant human-derived SIRT3 protein, expressed by E. coli , with tag free.

Background

SIRT3, a NAD-dependent protein deacetylase, intricately modulates the acetylation status of key lysine residues in various mitochondrial target proteins, including ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and ATP synthase subunit ATP5PO. By catalyzing deacetylation, SIRT3 actively participates in the regulation of cellular energy metabolism, exerting influence on tissue-specific ATP levels and contributing to the fine-tuning of metabolic responses. Under metabolic stress conditions, SIRT3 deacetylates the transcription factor FOXO3, recruiting both FOXO3 and mitochondrial RNA polymerase POLRMT to mitochondrial DNA, thereby enhancing mtDNA transcription. Additionally, SIRT3 plays a crucial role in ceramide metabolism by deacetylating ceramide synthases CERS1, CERS2, and CERS6, promoting mitochondrial ceramide accumulation. Furthermore, SIRT3 regulates hepatic lipogenesis by utilizing NAD(+) substrate imported by SLC25A47, triggering downstream activation of the PRKAA1/AMPK-alpha signaling cascade. This activation ultimately leads to the downregulation of sterol regulatory element-binding protein (SREBP) transcriptional activities, mitigating ATP-consuming lipogenesis and restoring cellular energy balance.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NTG7 (S118-K399)

Gene ID

23410

Molecular Construction
N-term
SIRT3 (S118-K399)
Accession # Q9NTG7
C-term
Protein Length

Partial

Synonyms
SIRT3; NAD-dependent protein deacetylase sirtuin-3; mitochondrial; hSIRT3; Regulatory protein SIR2 homolog 3; SIR2-like protein 3
AA Sequence

SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Molecular Weight

31.3 KDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SIRT3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SIRT3 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SIRT3 Protein, Human
Cat. No.:
HY-P701609
Quantity:
MCE Japan Authorized Agent: