SLPI Protein, Human (HEK293, Fc)

The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (HEK293, Fc) is the recombinant human-derived SLPI protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (HEK293, Fc) is the recombinant human-derived SLPI protein, expressed by HEK293 , with C-hFc labeled tag.

Background

SLPI, an acid-stable proteinase inhibitor, exhibits robust affinities for trypsin, chymotrypsin, elastase, and cathepsin G, as demonstrated in various studies. It plays a crucial role in modulating inflammatory and immune responses following bacterial infection, as well as infection by the intracellular parasite L.major. Additionally, SLPI contributes to down-regulating responses to bacterial lipopolysaccharide (LPS) (By similarity) and is involved in regulating the activation of NF-kappa-B, thereby influencing inflammatory responses. Notably, SLPI exhibits antimicrobial activity against mycobacteria but not against salmonella, contributing to normal resistance against infection by M.tuberculosis. It is also essential for normal resistance to infection by L.major and plays a critical role in wound healing, likely by preventing tissue damage through the regulation of protease activity (By similarity). Furthermore, in collaboration with ELANE, SLPI is required for the normal differentiation and proliferation of bone marrow myeloid cells, and it interacts with GRN, protecting progranulin from proteolysis.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SLPI (S26-A132)
      Accession # P03973
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SLPI; Secretory Leukocyte Protease Inhibitor (Antileukoproteinase); Secretory Leukocyte Peptidase Inhibitor; WAP Four-Disulfide Core Domain Protein 4; WFDC4; Seminal Proteinase Inhibitor; BLPI; Mucus Proteinase Inhibitor; WAP4; Protease Inhibitor WAP4; AL

  • AA Sequence

    SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

  • Predicted Molecular Mass

    38.5 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00