SLPI Protein, Human (HEK293, Fc)
The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (HEK293, Fc) is the recombinant human-derived SLPI protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (HEK293, Fc) is the recombinant human-derived SLPI protein, expressed by HEK293 , with C-hFc labeled tag.
Background
SLPI, an acid-stable proteinase inhibitor, exhibits robust affinities for trypsin, chymotrypsin, elastase, and cathepsin G, as demonstrated in various studies. It plays a crucial role in modulating inflammatory and immune responses following bacterial infection, as well as infection by the intracellular parasite L.major. Additionally, SLPI contributes to down-regulating responses to bacterial lipopolysaccharide (LPS) (By similarity) and is involved in regulating the activation of NF-kappa-B, thereby influencing inflammatory responses. Notably, SLPI exhibits antimicrobial activity against mycobacteria but not against salmonella, contributing to normal resistance against infection by M.tuberculosis. It is also essential for normal resistance to infection by L.major and plays a critical role in wound healing, likely by preventing tissue damage through the regulation of protease activity (By similarity). Furthermore, in collaboration with ELANE, SLPI is required for the normal differentiation and proliferation of bone marrow myeloid cells, and it interacts with GRN, protecting progranulin from proteolysis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P03973 (S26-A132)
-
Molecular Construction
-
N-term
-
SLPI (S26-A132)
Accession # P03973 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SLPI; Secretory Leukocyte Protease Inhibitor (Antileukoproteinase); Secretory Leukocyte Peptidase Inhibitor; WAP Four-Disulfide Core Domain Protein 4; WFDC4; Seminal Proteinase Inhibitor; BLPI; Mucus Proteinase Inhibitor; WAP4; Protease Inhibitor WAP4; AL
-
AA Sequence
SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
-
Predicted Molecular Mass
38.5 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)