SLPI Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The SLPI protein is an acid-stable protease inhibitor that modulates immune responses to bacterial infections.It downregulates responses to bacterial lipopolysaccharide (LPS) and modulates NF-kappa-B activation and inflammatory responses.SLPI Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SLPI protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SLPI protein is an acid-stable protease inhibitor that modulates immune responses to bacterial infections.It downregulates responses to bacterial lipopolysaccharide (LPS) and modulates NF-kappa-B activation and inflammatory responses.SLPI Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SLPI protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The jGranzyme B/GZMB protein is an abundant protease found in the cytosolic granules of cytotoxic T-cells and NK-cells. It plays a crucial role in various cellular processes. When delivered into the target cell through the immunological synapse, Granzyme B/GZMB activates caspase-independent pyroptosis, leading to target cell death. It achieves this by cleaving after Asp and catalyzing the cleavage of gasdermin-E (GSDME), releasing the pore-forming component of GSDME, which triggers pyroptosis. Granzyme B/GZMB is also involved in the activation cascade of caspases, including caspase-3, -9, and -7, which are responsible for apoptosis execution and plasma membrane repair in response to bacterial infection. Moreover, the Acid-stable proteinase inhibitor SLPI Protein exhibits strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. It modulates the innate immune response after bacterial infection and contributes to regulating the inflammatory and immune responses to the intracellular parasite L.major. SLPI Protein also down-regulates responses to bacterial lipopolysaccharide (LPS) and plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Additionally, it has antimicrobial activity against mycobacteria, contributes to normal resistance against infection by M.tuberculosis, and is required for normal resistance to L.major. SLPI Protein is also involved in wound healing by preventing tissue damage through limiting protease activity. It interacts with GRN and this interaction protects progranulin from proteolysis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SLPI (G26-M131)
      Accession # P97430
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SLPI; Secretory Leukocyte Protease Inhibitor (Antileukoproteinase); Secretory Leukocyte Peptidase Inhibitor; WAP Four-Disulfide Core Domain Protein 4; WFDC4; Seminal Proteinase Inhibitor; BLPI; Mucus Proteinase Inhibitor; WAP4; Protease Inhibitor WAP4; AL

  • AA Sequence

    GKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM

  • Predicted Molecular Mass

    38.5 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 350 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00