1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Smad Family
  5. SMAD5
  6. SMAD5 Protein, Mouse (sf9, His-GST)

SMAD5 (dwarfin C, JV5-1, MAD5) is a receptor activated Smad (R-Smad) belonging to the dwarfin/SMAD family. SMAD5 protein is activated by TGF-β receptor type I and binds to SMAD4 to form a trimer active form. SMAD5 is involved in BMP signaling pathway, regulates osteogenesis and is related to embryonic development. SMAD5 can up-regulate Runx2 expression and target osteocalcin and alkaline phosphatase (ALP) to function. SMAD5 Protein, Mouse (sf9, His-GST) has 464 amino acids expressed by sf9 insect cells with N-terminal His- and GST-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SMAD5 (dwarfin C, JV5-1, MAD5) is a receptor activated Smad (R-Smad) belonging to the dwarfin/SMAD family. SMAD5 protein is activated by TGF-β receptor type I and binds to SMAD4 to form a trimer active form. SMAD5 is involved in BMP signaling pathway, regulates osteogenesis and is related to embryonic development. SMAD5 can up-regulate Runx2 expression and target osteocalcin and alkaline phosphatase (ALP) to function[1]. SMAD5 Protein, Mouse (sf9, His-GST) has 464 amino acids expressed by sf9 insect cells with N-terminal His- and GST-tag.

Background

SMAD5 is a receptor activated Smad (R-Smad), also known as dwarfin C, JV5-1 and MAD5, which belong to the dwarfin/SMAD family. The SMAD5 protein consists of an N-terminal domain responsible for DNA binding, a C-terminal domain primarily used for protein-protein interactions, and a junction region containing moths necessary for ubiquitination degradation. SMAD5 is activated by an activated type I TGF-β receptor, and phosphorylated SMAD5 binds to SMAD4 (common SMAD) to form heterotrimer complexes that enter the nucleus as transcription factors. At the same time, SMAD4 is also bound by inhibitory SMAD (SMAD6 and SMAD7), making R-Smad compete for receptors or interact with Smad4, and target degradation and negative regulation of TGF-β signaling. SMAD5 mainly responds to BMP signaling pathways. During embryonic development, SMAD5 is widely expressed in mice from gastrum formation. During this period, the loss of SMAD5 leads to mutations in the embryo, or defects in the yolk sac outside the embryo, and death in the second trimester. Furthermore, the BMP/SMAD5 pathway can regulate osteogenesis by up-regulating transcription of the transcription factor Runx2, or by targeting multiple cis-acting promoter elements in osteogenic specific genes, including osteocalcin and alkaline phosphatase (ALP). Alps bind to Smad interacting protein 1 (SIP1) and inhibit Smad5-induced SIP1 activation. A significant expansion of primitive multipotent progenitor cells showing normal terminal maturation was reported in embryonic stem cells from Smad5-deficient mice, suggesting that conditional activation or deactivation of Smad5-specific signaling pathways may contribute to hematopoietic and osteogenic tissue engineering[1].

In Vivo

Smad5 is found to mediate TGF-β/BMP/MIS signaling in Smad5 knockout mice[2].

Species

Mouse

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P97454 (T2-S465)

Gene ID
Molecular Construction
N-term
His-GST
SMAD5 (T2-S465)
Accession # P97454
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Mothers against decapentaplegic homolog 5; Dwarfin-C; SMAD 5
AA Sequence

TSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNAPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMAPDNSQPMDTSSNMIPQTMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS

Predicted Molecular Mass
79.9 kDa
Molecular Weight

Approximately 75-88 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

SMAD5 Protein, Mouse (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SMAD5 Protein, Mouse (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SMAD5 Protein, Mouse (sf9, His-GST)
Cat. No.:
HY-P74539
Quantity:
MCE Japan Authorized Agent: