SMAD5 Protein, Mouse (sf9)
SMAD5 (dwarfin C, JV5-1, MAD5) is a receptor activated Smad (R-Smad) belonging to the dwarfin/SMAD family. SMAD5 protein is activated by TGF-β receptor type I and binds to SMAD4 to form a trimer active form. SMAD5 is involved in BMP signaling pathway, regulates osteogenesis and is related to embryonic development. SMAD5 can up-regulate Runx2 expression and target osteocalcin and alkaline phosphatase (ALP) to function. SMAD5 Protein, Mouse (sf9) has 464 amino acids expressed by sf9 insect cells with tag free.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SMAD5 (dwarfin C, JV5-1, MAD5) is a receptor activated Smad (R-Smad) belonging to the dwarfin/SMAD family. SMAD5 protein is activated by TGF-β receptor type I and binds to SMAD4 to form a trimer active form. SMAD5 is involved in BMP signaling pathway, regulates osteogenesis and is related to embryonic development. SMAD5 can up-regulate Runx2 expression and target osteocalcin and alkaline phosphatase (ALP) to function[1]. SMAD5 Protein, Mouse (sf9) has 464 amino acids expressed by sf9 insect cells with tag free.
Background
SMAD5 is a receptor activated Smad (R-Smad), also known as dwarfin C, JV5-1 and MAD5, which belong to the dwarfin/SMAD family. The SMAD5 protein consists of an N-terminal domain responsible for DNA binding, a C-terminal domain primarily used for protein-protein interactions, and a junction region containing moths necessary for ubiquitination degradation. SMAD5 is activated by an activated type I TGF-β receptor, and phosphorylated SMAD5 binds to SMAD4 (common SMAD) to form heterotrimer complexes that enter the nucleus as transcription factors. At the same time, SMAD4 is also bound by inhibitory SMAD (SMAD6 and SMAD7), making R-Smad compete for receptors or interact with Smad4, and target degradation and negative regulation of TGF-β signaling. SMAD5 mainly responds to BMP signaling pathways. During embryonic development, SMAD5 is widely expressed in mice from gastrum formation. During this period, the loss of SMAD5 leads to mutations in the embryo, or defects in the yolk sac outside the embryo, and death in the second trimester. Furthermore, the BMP/SMAD5 pathway can regulate osteogenesis by up-regulating transcription of the transcription factor Runx2, or by targeting multiple cis-acting promoter elements in osteogenic specific genes, including osteocalcin and alkaline phosphatase (ALP). Alps bind to Smad interacting protein 1 (SIP1) and inhibit Smad5-induced SIP1 activation. A significant expansion of primitive multipotent progenitor cells showing normal terminal maturation was reported in embryonic stem cells from Smad5-deficient mice, suggesting that conditional activation or deactivation of Smad5-specific signaling pathways may contribute to hematopoietic and osteogenic tissue engineering[1].
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P97454 (T2-S465)
-
Molecular Construction
-
N-term
-
SMAD5 (T2-S465)
Accession # P97454 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SMAD5; SMAD, Mothers Against DPP Homolog 5; Prev. MADH5; Mothers Against DPP Homolog 5; JV5-1; Mothers Against DPP Homolog; Dwfc; SMAD Family Member; Mothers Against Decapentaplegic Homolog 5; MAD Homolog 5; MAD, Mothers Against Decapentaplegic Homolog 5
-
AA Sequence
TSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNAPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMAPDNSQPMDTSSNMIPQTMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
-
Predicted Molecular Mass
52.2 kDa
-
Molecular Weight
Approximately 57 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)