SNCA Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

SNCA Protein is a protein abnormally aggregated to form Lewy bodies. SNCA Protein causes neuronal differentiation and maturation disorders, inhibits neurite outgrowth, reduces neuronal electrical activity through increased gene copy number (such as triploidy) or mutation, and promotes the release of extracellular toxic particles (such as oligomers) by interfering with the autophagy-lysosomal pathway (ALP), thereby inducing inflammatory responses and damage to neighboring cells. SNCA Protein, Human is a recombinant SNCA protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

SNCA Protein is a protein abnormally aggregated to form Lewy bodies. SNCA Protein causes neuronal differentiation and maturation disorders, inhibits neurite outgrowth, reduces neuronal electrical activity through increased gene copy number (such as triploidy) or mutation, and promotes the release of extracellular toxic particles (such as oligomers) by interfering with the autophagy-lysosomal pathway (ALP), thereby inducing inflammatory responses and damage to neighboring cells. SNCA Protein, Human is a recombinant SNCA protein expressed by E. coli without a tag.

Background

SNCA Protein belongs to the synuclein family. SNCA Protein is a protein that abnormally aggregates to form Lewy bodies[1]. SNCA Protein causes neuronal differentiation and maturation disorders, inhibits neurite outgrowth, and reduces neuronal electrical activity through gene copy number increase (such as triploidy) or mutation. It also promotes the release of extracellular toxic particles (such as oligomers) by interfering with the autophagy-lysosomal pathway (ALP), thereby inducing inflammatory responses and neighboring cell damage[1][2][3]. SNCA Protein is mainly expressed in neurons of the central nervous system, especially enriched in dopaminergic neurons[1]. The normal activity of SNCA Protein is related to the dynamic regulation of synaptic vesicles and the release of neurotransmitters, but its abnormal aggregation under pathological conditions can damage mitochondrial function, induce oxidative stress, and spread toxicity between cells through exosomes and other pathways, exacerbating neurodegenerative diseases[1][2][3]. SNCA Protein, Human is encoded by the human SNCA gene. The protein contains 140 amino acid residues, and its aggregation tendency can be affected by post-translational modifications (such as phosphorylation and ubiquitination)[1][4].

Verified Bioactivity

1.Measured by its ability to inhibit cell proliferation of A549 cells. The ED50 for this effect is typically ≤15.86 ng/mL, corresponding to a specific activity is ≥6.31×104 units/mg.
2.Immobilized Recombinant Human SNCA at 2 μg/mL (100 μL/well) can bind Anti-Human SNCA antibody.The ED50 of AntiSNCA antibody is 2-5 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SNCA (M1-A140)
      Accession # P37840
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SNCA; Parkinson Disease (Autosomal Dominant, Lewy Body) 4; Prev. PARK1; Non-A4 Component Of Amyloid Precursor; Prev. PARK4; Non A-Beta Component Of AD Amyloid; Alpha-Synuclein; Non-A Beta Component Of AD Amyloid; NACP; Synuclein Alpha-140; PD1; I+/--Synuclein; Synuclein, Alpha (Non A4 Component Of Amyloid Precursor); Α-Synuclein; Synuclein Alpha; Non A4 Component Of Amyloid Precursor

  • AA Sequence

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

  • Predicted Molecular Mass

    14.5 kDa

  • Molecular Weight

    Approximately 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00