Copy Link Print Information

TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi)

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) is the recombinant dog-derived TARC/CCL17 protein, expressed by E. coli , with N-MBP, C-6*His-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Dog
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) is the recombinant dog-derived TARC/CCL17 protein, expressed by E. coli , with N-MBP, C-6*His-Avi labeled tag.

Background

TARC/CCL17 protein serves as a chemokine with specific chemotactic activity for T lymphocytes, particularly Th2 cells, while exhibiting no such attraction for monocytes or granulocytes. Its involvement extends to various inflammatory and immunological processes, facilitated by the binding to CCR4 on the surface of T cells. Additionally, TARC/CCL17 contributes to GM-CSF/CSF2-driven pain and inflammation. In the brain, this chemokine is crucial for maintaining the characteristic, highly branched morphology of hippocampal microglia under homeostatic conditions and may play a pivotal role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Moreover, TARC/CCL17 plays a significant role in wound healing, primarily by inducing fibroblast migration into the wound.

Technical Parameters

  • Species Dog
  • Source E. coli
  • Tag C-6*His;C-Avi;N-MBP
  • Accession

    Q95N01 (A24-S99)

  • Gene ID
    403586
  • Molecular Construction
    • N-term
    • MBP
    • CCL17 (A24-S99)
      Accession # Q95N01
    • 6*His-Avi
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    CCL17; Chemokine (C-C Motif) Ligand 17; Prev. SCYA17; C-C Motif Chemokine 17; TARC; CC Chemokine TARC; ABCD-2; T Cell-Directed CC Chemokine; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 17; A-152E5.3; Thymus And Activation-Regulated Chemokine; C

  • AA Sequence

    ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

  • Predicted Molecular Mass

    56.4 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) Product Image
    1/16
  • TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) Product Image