1. Recombinant Proteins
  2. Others
  3. Fetal-tau/0N3R Protein, Human (His)

Tau/0N3R protein is encoded by the Tau/0N3R gene and undergoes regulated alternative splicing to produce different mRNA species.Its expression varies in the nervous system according to the maturation and type of neurons.Fetal-tau/0N3R Protein, Human (His) is the recombinant human-derived Fetal-tau/0N3R protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tau/0N3R protein is encoded by the Tau/0N3R gene and undergoes regulated alternative splicing to produce different mRNA species.Its expression varies in the nervous system according to the maturation and type of neurons.Fetal-tau/0N3R Protein, Human (His) is the recombinant human-derived Fetal-tau/0N3R protein, expressed by E.coli , with N-6*His labeled tag.

Background

The Tau/0N3R gene encodes the microtubule-associated protein tau (MAPT), which undergoes intricate, regulated alternative splicing, generating various mRNA species. The expression of MAPT transcripts varies across the nervous system, contingent on the stage of neuronal maturation and the specific neuron type. Mutations in the MAPT gene have been implicated in several neurodegenerative disorders, including Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration, and progressive supranuclear palsy. With biased expression observed in the brain (RPKM 70.2), kidney (RPKM 12.0), and two other tissues, Tau/0N3R plays a pivotal role in neurophysiology and is associated with diverse neuropathological conditions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P10636-2/NP_058525.1 (A2-L352)

Gene ID

4137

Molecular Construction
N-term
6*His
Tau (A2-L352)
Accession # NP_058525.1
C-term
Protein Length

Full Length of Isoform-2 Mature Protein

Synonyms
MAPT; Mtapt; Tau; Microtubule-associated protein tau; PHF-tau
AA Sequence

AEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Molecular Weight

40-50 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fetal-tau/0N3R Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fetal-tau/0N3R Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fetal-tau/0N3R Protein, Human (His)
Cat. No.:
HY-P73618A
Quantity:
MCE Japan Authorized Agent: