Fetal-tau/0N3R Protein, Human (His)
Based on 1 Customer Validation
Tau/0N3R protein is encoded by the Tau/0N3R gene and undergoes regulated alternative splicing to produce different mRNA species.Its expression varies in the nervous system according to the maturation and type of neurons.Fetal-tau/0N3R Protein, Human (His) is the recombinant human-derived Fetal-tau/0N3R protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Tau/0N3R protein is encoded by the Tau/0N3R gene and undergoes regulated alternative splicing to produce different mRNA species.Its expression varies in the nervous system according to the maturation and type of neurons.Fetal-tau/0N3R Protein, Human (His) is the recombinant human-derived Fetal-tau/0N3R protein, expressed by E.coli , with N-6*His labeled tag.
Background
The Tau/0N3R gene encodes the microtubule-associated protein tau (MAPT), which undergoes intricate, regulated alternative splicing, generating various mRNA species. The expression of MAPT transcripts varies across the nervous system, contingent on the stage of neuronal maturation and the specific neuron type. Mutations in the MAPT gene have been implicated in several neurodegenerative disorders, including Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration, and progressive supranuclear palsy. With biased expression observed in the brain (RPKM 70.2), kidney (RPKM 12.0), and two other tissues, Tau/0N3R plays a pivotal role in neurophysiology and is associated with diverse neuropathological conditions.
Verified Bioactivity
Loaded Posdinemab (HY-P9995) on AHC2 biosensor, can bind Fetal-tau/0N3R Protein, Human (His) with an affinity constant of 4.928E-07 M as determined in BLI assay.
MCE Validation Data
-
Bioactivity - BLI
Bioactivity - BLI
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P10636-2/NP_058525.1 (A2-L352)
-
Gene ID4137
-
Molecular Construction
-
N-term
-
6*His
-
Tau (A2-L352)
Accession # NP_058525.1 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
MAPT; Tau-Derived Paired Helical Filament Hexapeptide; Prev. MAPTL; Microtubule-Associated Protein Tau; Prev. DDPAC; Neurofibrillary Tangle Protein; MTBT1; Paired Helical Filament-Tau; PPP1R103; MGC138549; Tau-PHF6; FLJ31424; FTDP-17; PHF-Tau; Tau-40; Mic
-
AA Sequence
AEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
-
Predicted Molecular Mass
36.6 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)