TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His)

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.

Transforming growth factor-beta (TGF-β) is a pleiotropic cytokine with the capability to act as tumor suppressor or tumor promoter depending on the cellular context. TGF-beta receptor type-2 (TGFBR2) is the ligand-binding receptor for all members of the TGF-βfamily and expressed in virtually all cell types including fibroblasts. Regulation of tumor-stromal cross-talk through fibroblastic TGF-βpathway may depend on fibroblast phenotype, emphasising the importance to characterise tumor microenvironment subtypes^[1].

1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED₅₀ for this effect is 7.946 ng/mL in the presence of 1 ng/mL of rhTGF-beta 1 (HY-P7118), corresponding to a specific activity is 1.258×10⁵ units/mg.

• 
  Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED₅₀ for this effect is 7.946 ng/mL in the presence of 1 ng/mL of rhTGF-beta 1 (HY-P7118), corresponding to a specific activity is 1.258×10⁵ units/mg.

Mouse

HEK293

N-6*His

Q62312-2 (I24-D159)

21813  [NCBI]

Partial

IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD

Approximately 25-38 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Busch S, et al. TGF-beta receptor type-2 expression in cancer-associated fibroblasts regulates breast cancer cell growth and survival and is a prognostic marker in pre-menopausal breast cancer. Oncogene. 2015 Jan 2;34(1):27-38.  [Content Brief]