TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.
Background
Transforming growth factor-beta (TGF-β) is a pleiotropic cytokine with the capability to act as tumor suppressor or tumor promoter depending on the cellular context. TGF-beta receptor type-2 (TGFBR2) is the ligand-binding receptor for all members of the TGF-βfamily and expressed in virtually all cell types including fibroblasts. Regulation of tumor-stromal cross-talk through fibroblastic TGF-βpathway may depend on fibroblast phenotype, emphasising the importance to characterise tumor microenvironment subtypes[1].
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED50 for this effect is 7.946 ng/mL in the presence of 1 ng/mL of rhTGF-beta 1 (HY-P7118), corresponding to a specific activity is 1.258×105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-6*His
-
Accession
Q62312-2 (I24-D159)
-
Molecular Construction
-
N-term
-
6*His
-
TGFBR2 (I24-D159)
Accession # Q62312-2 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TGFBR2; Transforming Growth Factor, Beta Receptor II Gamma; Prev. MFS2; Transforming Growth Factor, Beta Receptor II Beta; TGF-Beta Type II Receptor; Serine/Threonine-Protein Kinase Receptor; TGF-Beta Receptor Type-2; Receptor Protein Serine/Threonine Kin
-
AA Sequence
IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD
-
Predicted Molecular Mass
16.2 kDa
-
Molecular Weight
Approximately 25-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
