1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Decoy Receptor 1
  6. TNFRSF10C Protein, Human (210a.a, HEK293, His)

TNFRSF10C Protein, Human (210a.a, HEK293, His)

Cat. No.: HY-P76860
Handling Instructions Technical Support

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (210a.a, HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (210a.a, HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-His labeled tag.

Background

The TNFRSF10C Protein serves as a receptor for the cytotoxic ligand TRAIL; however, it lacks a cytoplasmic death domain, rendering it incapable of inducing apoptosis. Instead, TNFRSF10C may play a protective role in cells by competing with TRAIL-R1 and R2 for binding to the ligand, potentially acting as a decoy receptor and thereby mitigating TRAIL-mediated apoptosis. This unique feature highlights the regulatory complexity of TNFRSF10C in modulating cellular responses to TRAIL signaling and suggests its involvement in fine-tuning the balance between survival and apoptotic pathways.

Species

Human

Source

HEK293

Tag

C-His

Accession

O14798 (A26-P235)

Gene ID
Molecular Construction
N-term
TNFRSF10C (A26-P235)
Accession # O14798
His
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 10C; DcR1; TRAIL-R3; CD263
AA Sequence

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP

Predicted Molecular Mass
23.6 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TNFRSF10C Protein, Human (210a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF10C Protein, Human (210a.a, HEK293, His)
Cat. No.:
HY-P76860
Quantity:
MCE Japan Authorized Agent: