TNFRSF10C Protein, Human (210a.a, HEK293, His)
Based on 1 Customer Validation
The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (210a.a, HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (210a.a, HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-His labeled tag.
Background
The TNFRSF10C Protein serves as a receptor for the cytotoxic ligand TRAIL; however, it lacks a cytoplasmic death domain, rendering it incapable of inducing apoptosis. Instead, TNFRSF10C may play a protective role in cells by competing with TRAIL-R1 and R2 for binding to the ligand, potentially acting as a decoy receptor and thereby mitigating TRAIL-mediated apoptosis. This unique feature highlights the regulatory complexity of TNFRSF10C in modulating cellular responses to TRAIL signaling and suggests its involvement in fine-tuning the balance between survival and apoptotic pathways.
Verified Bioactivity
Immobilized human TNFRSF10C at 2 μg/mL (100 μL/well) can bind biotinylated human TNFSF10, the EC50 of biotinylated human TNFSF10 is 0.001-0.7 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
O14798 (A26-P235)
-
Molecular Construction
-
N-term
-
TNFRSF10C (A26-P235)
Accession # O14798 -
His
-
C-term
-
-
Protein Length
Full Length of Tumor necrosis factor receptor superfamily member 10C Chain
-
Synonyms
TNFRSF10C; Decoy TRAIL Receptor Without Death Domain; TNF Receptor Superfamily Member 10c; Lymphocyte Inhibitor Of TRAIL; TRAILR3; Decoy Receptor 1; DcR1; TRAIL-R3; TRID; TRAIL Receptor Without An Intracellular Domain; LIT; Cytotoxic TRAIL Receptor-3; CD2
-
AA Sequence
ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP
-
Predicted Molecular Mass
23.6 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
