TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His)
TRAIL R1/TNFRSF10A protein is a receptor for TNFSF10/TRAIL, which recruits caspase-8 through FADD to initiate cell apoptosis and form a death-inducing signaling complex (DISC). It activates NF-kappa-B and interacts with TRADD and RIPK1 in the monomeric state. TRAIL R1/TNFRSF10A Protein, Human (239a.a, HEK293, His) is the recombinant human-derived TRAIL R1/TNFRSF10A, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRAIL R1/TNFRSF10A protein is a receptor for TNFSF10/TRAIL, which recruits caspase-8 through FADD to initiate cell apoptosis and form a death-inducing signaling complex (DISC). It activates NF-kappa-B and interacts with TRADD and RIPK1 in the monomeric state. TRAIL R1/TNFRSF10A Protein, Human (239a.a, HEK293, His) is the recombinant human-derived TRAIL R1/TNFRSF10A, expressed by HEK293, with C-His labeled tag.
Background
The TRAIL R1/TNFRSF10A Protein serves as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon activation, the adapter molecule FADD recruits caspase-8 to the receptor, forming the death-inducing signaling complex (DISC), leading to caspase-8 proteolytic activation and initiating the subsequent cascade of caspases, mediating apoptosis. Additionally, TRAIL R1/TNFRSF10A promotes the activation of NF-kappa-B. In its monomeric state, it can interact with TRADD and RIPK1. Moreover, TRAIL R1/TNFRSF10A forms homooligomers and heterooligomers with TNFRSF10B, and three TRAIL R1 molecules interact with the TNFSF10 homotrimer. The receptor also interacts with ARAP1 and ZDHHC3, further highlighting its involvement in complex signaling networks. In the absence of stimulation, TRAIL R1/TNFRSF10A interacts with BIRC2, DDX3X, and GSK3B, and this interaction is enhanced upon receptor stimulation, accompanied by cleavage of DDX3X and BIRC2. These intricate interactions emphasize the multifaceted role of TRAIL R1/TNFRSF10A in apoptotic and signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
O00220 (A109-N239)
-
Molecular Construction
-
N-term
-
TRAIL-R1 (A109-N239)
Accession # O00220 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFRSF10A; Death Receptor 4; TNF Receptor Superfamily Member 10a; TRAIL Receptor 1; TRAILR1; TRAIL-R1; DR4; Tumor Necrosis Factor Receptor Superfamily Member 10a Variant 2; TRAILR-1; Tumor Necrosis Factor Receptor Superfamily Member 10a; CD261; Alternativ
-
AA Sequence
ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN
-
Predicted Molecular Mass
15.7 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)