1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Death Receptor 4
  6. TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His)

TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His)

Cat. No.: HY-P74501
Handling Instructions Technical Support

TRAIL R1/TNFRSF10A protein is a receptor for TNFSF10/TRAIL, which recruits caspase-8 through FADD to initiate cell apoptosis and form a death-inducing signaling complex (DISC). It activates NF-kappa-B and interacts with TRADD and RIPK1 in the monomeric state. TRAIL R1/TNFRSF10A Protein, Human (239a.a, HEK293, His) is the recombinant human-derived TRAIL R1/TNFRSF10A, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRAIL R1/TNFRSF10A protein is a receptor for TNFSF10/TRAIL, which recruits caspase-8 through FADD to initiate cell apoptosis and form a death-inducing signaling complex (DISC). It activates NF-kappa-B and interacts with TRADD and RIPK1 in the monomeric state. TRAIL R1/TNFRSF10A Protein, Human (239a.a, HEK293, His) is the recombinant human-derived TRAIL R1/TNFRSF10A, expressed by HEK293, with C-His labeled tag.

Background

The TRAIL R1/TNFRSF10A Protein serves as a receptor for the cytotoxic ligand TNFSF10/TRAIL. Upon activation, the adapter molecule FADD recruits caspase-8 to the receptor, forming the death-inducing signaling complex (DISC), leading to caspase-8 proteolytic activation and initiating the subsequent cascade of caspases, mediating apoptosis. Additionally, TRAIL R1/TNFRSF10A promotes the activation of NF-kappa-B. In its monomeric state, it can interact with TRADD and RIPK1. Moreover, TRAIL R1/TNFRSF10A forms homooligomers and heterooligomers with TNFRSF10B, and three TRAIL R1 molecules interact with the TNFSF10 homotrimer. The receptor also interacts with ARAP1 and ZDHHC3, further highlighting its involvement in complex signaling networks. In the absence of stimulation, TRAIL R1/TNFRSF10A interacts with BIRC2, DDX3X, and GSK3B, and this interaction is enhanced upon receptor stimulation, accompanied by cleavage of DDX3X and BIRC2. These intricate interactions emphasize the multifaceted role of TRAIL R1/TNFRSF10A in apoptotic and signaling pathways.

Species

Human

Source

HEK293

Tag

C-His

Accession

O00220 (A109-N239)

Gene ID
Molecular Construction
N-term
TRAIL-R1 (A109-N239)
Accession # O00220
His
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 10A; TRAIL-R1; CD261; APO2; DR4
AA Sequence

ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN

Predicted Molecular Mass
15.7 kDa
Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAIL R1/TNFRSF10A Protein, Human (131a.a, HEK293, His)
Cat. No.:
HY-P74501
Quantity:
MCE Japan Authorized Agent: