1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. UBASH3B/STS1 Protein, Human (His)

UBASH3B/STS1 protein blocks CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activating receptors such as T cell receptors and EGFR on the cell surface. It exhibits tyrosine phosphatase activity against substrates such as EGFR, FAK, SYK and ZAP70. UBASH3B/STS1 Protein, Human (His) is the recombinant human-derived UBASH3B/STS1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE UBASH3B/STS1 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBASH3B/STS1 protein blocks CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activating receptors such as T cell receptors and EGFR on the cell surface. It exhibits tyrosine phosphatase activity against substrates such as EGFR, FAK, SYK and ZAP70. UBASH3B/STS1 Protein, Human (His) is the recombinant human-derived UBASH3B/STS1 protein, expressed by E. coli , with N-His labeled tag.

Background

UBASH3B/STS1 protein disrupts the CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Additionally, it demonstrates tyrosine phosphatase activity towards multiple substrates, including EGFR, FAK, SYK, and ZAP70. Furthermore, UBASH3B/STS1 participates in the down-regulation of proteins that undergo dual modification involving both protein tyrosine phosphorylation and ubiquitination.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8TF42 (Q382-E649)

Gene ID
Molecular Construction
N-term
His
UBASH3B (Q382-E649)
Accession # Q8TF42
C-term
Protein Length

Partial

Synonyms
Ubiquitin-associated and SH3 domain-containing protein B; STS-1; TULA-2; UBASH3B
AA Sequence

QKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

Predicted Molecular Mass
31.9 kDa
Molecular Weight

Approximately 32-34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

UBASH3B/STS1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UBASH3B/STS1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBASH3B/STS1 Protein, Human (His)
Cat. No.:
HY-P74484
Quantity:
MCE Japan Authorized Agent: