VEGF165 Protein, Human (Biotinylated, HEK293, C-6*His-Avi)
VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (Biotinylated, HEK293, C-6*His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (Biotinylated, HEK293, C-6*His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
VEGF165 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF165 may be secreted by tumour cells, binds with high affinity to VEGFR-1 and VEGFR-2 receptors[1][2][3][4][5][6][7][8].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His;C-Avi
-
Accession
P15692-4 (A27-R191)
-
Gene ID7422
-
Molecular Construction
-
N-term
-
VEGF165 (A27-R191)
Accession # P15692-4 -
6*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial Growth Factor; VEGFA Protein; MVCD1
-
AA Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
-
Predicted Molecular Mass
22.2 kDa
-
Molecular Weight
Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Homodimer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
