1. Recombinant Proteins
  2. Viral Proteins
  3. HIV Proteins
  4. Vpr Protein, HIV-1 group M subtype K (His, Myc)

Vpr Protein, HIV-1 group M subtype K (His, Myc)

Cat. No.: HY-P704057
Handling Instructions Technical Support

Vpr Protein, HIV-1 group M subtype K (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Vpr Protein, HIV-1 group M subtype K (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.

Background

Vpr is a protein that may deplete host UNG protein and induce G2-M cell cycle arrest during virus replication. It acts by targeting specific host proteins for degradation by the 26S proteasome through association with the cellular CUL4A-DDB1 E3 ligase complex via direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting initiation by Vpr carried into the virion. Additionally, Vpr induces apoptosis in a cell cycle-dependent manner, indicating mechanistic linkage between these effects. Detected in AIDS patient serum and cerebrospinal fluid, Vpr may also induce bystander cell death.

Species

Virus

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P0C1P2 (M1-S96)

Molecular Construction
N-term
10*His
(M1-S96)
Accession # P0C1P2
Myc
C-term
Protein Length

Full Length

Synonyms
R ORF protein; Viral protein R
AA Sequence

MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS

Predicted Molecular Mass
14 kDa
분자량

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Vpr Protein, HIV-1 group M subtype K (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Vpr Protein, HIV-1 group M subtype K (His, Myc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Vpr Protein, HIV-1 group M subtype K (His, Myc)
Cat. No.:
HY-P704057
수량:
MCE Japan Authorized Agent: