Urocortin II, mouse
Based on 1 Customer Validation
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.
For research use only. We do not sell to patients.
- Purity: 99.94%
- CAS No.: 330648-32-3
- Formula: C187H320N56O50
- Molecular Weight:4152.96
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
|
CRFR2 0.66 nM (Ki) |
CRFR1 ﹥100 nM (Ki) |
Urocortin II, mouse elicits positive inotropic and positive lusitropic effects in mouse ventricular myocytes via activation of CRF2 receptors[1].
Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Urocortin II, mouse (1 μg; icv; Adult male Sprague-Dawley rats) is involved in central autonomic nervous system and appetite control[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Adult male Sprague-Dawley rats (250-300 g)[2]
-
Dosage:1, 5, and 10 μg
-
Administration:Intracerebroventrical injection and intravenous injection; 1, 5, or 10 μg per animal in 2 μL of saline for i.c.v. injections or 200 μL for i.v. administration
-
Result:Induced Fos expression in a dose-dependent manner.
-
Animal Model:Adult male Sprague-Dawley rats (250-300 g)[2]
-
Dosage:1 μg
-
Administration:Intracerebroventrical injection
-
Result:Reduced food intake over the 12-h interval.
Chemical Information
-
CAS No. 330648-32-3
-
Appearance Solid
-
Molecular Weight 4152.96
-
Formula C187H320N56O50
-
Color White to off-white
-
Sequence
Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2
-
Sequence Shortening
VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 50 mg/mL (12.04 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (286 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yang LZ, et, al. cAMP- and Ca²(+) /calmodulin-dependent protein kinases mediate inotropic, lusitropic and arrhythmogenic effects of urocortin 2 in mouse ventricular myocytes. Br J Pharmacol. 2011 Jan;162(2):544-56. [Content Brief]
[2]. Reyes TM, et, al. Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2843-8. [Content Brief]
[3]. Reyes TM, et, al. Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2843-8. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2408 mL | 1.2040 mL | 2.4079 mL | 6.0198 mL |
| 5 mM | 0.0482 mL | 0.2408 mL | 0.4816 mL | 1.2040 mL | |
| 10 mM | 0.0241 mL | 0.1204 mL | 0.2408 mL | 0.6020 mL |
Urocortin II, mouse Related Classifications
HY-P2847 Related Classifications
Powered by Bioz