Urocortin III (human)
Based on 1 Customer Validation
Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) potently binds to type 2 CRF receptors, specifically mCRF2β (Ki = 13.5 nM) and rCRF2α (Ki = 21.7 nM), while demonstrating negligible affinity for hCRF1 (Ki >100 nM). Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion[1][2].
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity : 99.81%
- CAS No.: 357952-09-1
- 화학식: C185H307N53O50S2
- 분자량:4137.93
-
보관:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
용액&용해도
- Protocol
- 순도&문서
- References
-
Help & FAQs
-
HY-P1295
Urocortin, humanCRF Receptor Agonist -
HY-P0086
Corticotropin-releasing factor (human)CRFR Modulator -
HY-P1296
Urocortin, ratCRFR Agonist -
HY-P0060A
Tetracosactide acetateMC4R Agonist -
HY-14127
R121919CRF1 Receptor Antagonist -
HY-103377
Antalarmin hydrochlorideCRHR1 Antagonist -
HY-12129
CP 154526 hydrochlorideCRF1 Antagonist -
HY-P0257
AstressinCRF Antagonist -
HY-W539944
Argipressin acetateVasopressin Receptor Agonist -
HY-14130
CP 376395CRF1 Receptor Antagonist -
HY-P1106
K41498CRF2 receptor Antagonist -
HY-P1097
Gastrin I, humanCCK2 Agonist
Biological Activity
제품 설명
IC50 & Target
[1]|
mCRF2β 13.5 nM (Ki) |
rCRF2α 21.7 nM (Ki) |
In Vitro
Urocortin III (human) (0.001-1000 nM, 20 min) induces intracellular cAMP accumulation in CHO cells stably expressing murine CRF-R2[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 357952-09-1
-
Appearance Solid
-
분자량 4137.93
-
화학식 C185H307N53O50S2
-
Color White to off-white
-
Sequence
Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
-
Sequence Shortening
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
용액&용해도
In Vitro:
DMSO : 10 mg/mL (2.42 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
순도&문서
-
Data Sheet (285 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Lewis K, et, al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. [Content Brief]
[2]. van der Meulen T, et, al. Urocortin3 mediates somatostatin-dependent negative feedback control of insulin secretion. Nat Med. 2015 Jul;21(7):769-76. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2417 mL | 1.2083 mL | 2.4167 mL | 6.0417 mL |
Urocortin III (human) Related Classifications
HY-P3019 Related Classifications
Powered by Bioz