Urocortin III (human)

Cat. No.: HY-P3019: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with K_i values of 13.5, 21.7, and >100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urocortin III (human) Chemical Structure

CAS No. : 357952-09-1

Size	Price	Stock	Quantity
500 μg	USD 430	Get quote 2 weeks 1 week	Estimated Time of Arrival: December 31

Synthetic products have potential research and development risk.

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with K_i values of 13.5, 21.7, and >100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion^[1]^[2].
IC₅₀ & Target	Ki: 13.5 (mCRF2β), 21.7 (rCRF2α), and >100 nM ( hCRF1)^[1]
In Vitro	Urocortin III (human) (20 min; CHO cells stably expressing either cloned human CRF-R1 or murine CRF-R2) indices intracellular cAMP accumulation in cells^[1]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Urocortin III (human) Related Antibodies
Molecular Weight	4137.93
Formula	C₁₈₅H₃₀₇N₅₃O₅₀S₂
CAS No.	357952-09-1
Sequence	Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
Sequence Shortening	FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (261 KB) Handling Instructions (2659 KB)
References	[1]. Lewis K, et, al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. [Content Brief] [2]. van der Meulen T, et, al. Urocortin3 mediates somatostatin-dependent negative feedback control of insulin secretion. Nat Med. 2015 Jul;21(7):769-76. [Content Brief]