country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5780

Copy Link Print Information

π-TRTX-Hm3a

π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC₅₀ of 1-2 nM and potentiates ASIC1b with an EC₅₀ of 46.5 nM.

For research use only. We do not sell to patients.

Formula: C₁₈₆H₂₉₀N₅₆O₄₉S₆
Molecular Weight:4287.03

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

π-TRTX-Hm3a Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All Sodium Channel Isoforms :

Chemical Information

Molecular Weight 4287.03
Formula C₁₈₆H₂₉₀N₅₆O₄₉S₆
Sequence

Glu-Pro-Cys-Ile-Pro-Lys-Trp-Lys-Ser-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Ala-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Lys-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Val (Disulfide bridge:Cys3-Cys18;Cys10-Cys23;Cys17-Cys33)
Sequence Shortening

EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV (Disulfide bridge:Cys3-Cys18;Cys10-Cys23;Cys17-Cys33)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Sing Yan Er, et al. Discovery and molecular interaction studies of a highly stable, tarantula peptide modulator of acid-sensing ion channel 1. Neuropharmacology. 2017 Dec:127:185-195. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock